mphC

Accession ARO:3000319
CARD Short NamemphC
DefinitionThe mphC gene was identified from Staphylococcus aureus. This gene shows similarity to mphB gene from Escherchia coli.
AMR Gene Familymacrolide phosphotransferase (MPH)
Drug Classmacrolide antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Sequence VariantsEscherichia coliwgs, Klebsiella pneumoniaewgs, Listeria monocytogeneswgs, Pseudomonas aeruginosawgs, Salmonella entericawgs, Staphylococcus arlettaeg+wgs, Staphylococcus aureusg+p+wgs, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+p+wgs, Staphylococcus equorumg+p+wgs, Staphylococcus haemolyticusg+p+wgs, Staphylococcus hominisp+wgs, Staphylococcus massiliensiswgs, Staphylococcus saprophyticusp+wgs, Staphylococcus simulanswgs, Staphylococcus warneriwgs, Stenotrophomonas maltophiliawgs, Vibrio choleraewgs
Classification9 ontology terms | Show
Parent Term(s)10 ontology terms | Show
+ macrolide phosphotransferase (MPH) [AMR Gene Family]
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic roxithromycin [Antibiotic]
+ confers_resistance_to_antibiotic telithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clarithromycin [Antibiotic]
+ confers_resistance_to_antibiotic tylosin [Antibiotic]
+ confers_resistance_to_antibiotic spiramycin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ confers_resistance_to_antibiotic dirithromycin [Antibiotic]
+ confers_resistance_to_antibiotic oleandomycin [Antibiotic]
Publications

Matsuoka M, et al. 2003. FEMS Microbiol Lett 220(2): 287-293. Characteristic expression of three genes, msr(A), mph(C) and erm(Y), that confer resistance to macrolide antibiotics on Staphylococcus aureus. (PMID 12670694)

Chesneau O, et al. 2007. FEMS Microbiol Lett 269(2): 317-322. Resistance phenotypes conferred by macrolide phosphotransferases. (PMID 17302923)

Pawlowski AC, et al. 2018. Nat Commun 9(1):112 The evolution of substrate discrimination in macrolide antibiotic resistance enzymes. (PMID 29317655)

Resistomes

Prevalence of mphC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Escherichia coli0%0%0.01%0%
Klebsiella pneumoniae0%0%0.01%0%
Listeria monocytogenes0%0%0.05%0%
Pseudomonas aeruginosa0%0%0.02%0%
Salmonella enterica0%0%0.01%0%
Staphylococcus arlettae25%0%20%0%
Staphylococcus aureus2.52%3.58%9.38%0%
Staphylococcus capitis14.29%0%0.65%0%
Staphylococcus epidermidis1.82%1.94%15.04%0%
Staphylococcus equorum33.33%3.57%46.51%0%
Staphylococcus haemolyticus29.17%2.33%30.99%0%
Staphylococcus hominis0%6.52%17.44%0%
Staphylococcus massiliensis0%0%14.29%0%
Staphylococcus saprophyticus0%5.41%11.28%0%
Staphylococcus simulans0%0%1.67%0%
Staphylococcus warneri0%0%3.51%0%
Stenotrophomonas maltophilia0%0%0.17%0%
Vibrio cholerae0%0%0.14%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|BAA34540.1|+|mphC [Staphylococcus aureus]
MTRHNEIIKCAEKYQLHIQPQTISLNESGLDFQVAFGKDKHGVEWVLRLPRRPDVYKRTKPEKQTVDFLQKNVSFEVPKWKVHERDLIAY
PKLTGKPAATIDPEIQNYVWEIEHKPLPENFINTLAETLVDLHNIPEENINVQHINIKTIQEIKNDFQRRMNKVKETYGVSDELWNRWKQ
WLENDELWPRHATMIHGDLHPGHIMVDNQANVTGLIDWTEATHSDPSMDFMGHHRVFDDEGLEQLITAYGKAGGEIWPRMKEHIIELNAV
FPMFIAEFAMESGESAYETMALKELGMKE


>gb|AB013298.1|+|2296-3195|mphC [Staphylococcus aureus]
ATGACTCGACATAATGAAATTATTAAATGTGCAGAAAAATATCAATTACACATCCAACCTCAAACAATCTCATTGAATGAATCGGGACTT
GATTTCCAAGTTGCATTTGGAAAAGATAAACATGGAGTAGAATGGGTTTTGAGACTGCCAAGAAGACCTGATGTTTATAAACGAACAAAA
CCCGAAAAACAAACGGTAGACTTCTTACAGAAGAATGTTTCATTTGAAGTACCGAAATGGAAAGTACACGAAAGAGACCTTATTGCGTAT
CCAAAACTTACAGGTAAACCCGCAGCCACAATAGATCCAGAAATACAAAATTATGTATGGGAAATTGAACACAAACCATTACCAGAAAAC
TTTATTAACACATTAGCTGAAACACTCGTAGATTTACACAACATACCAGAAGAAAACATTAACGTTCAGCATATAAATATCAAAACCATA
CAAGAAATAAAAAATGACTTTCAAAGAAGAATGAATAAAGTTAAAGAAACTTATGGTGTATCAGATGAATTATGGAACAGATGGAAACAA
TGGTTAGAAAACGACGAACTATGGCCTCGACATGCGACCATGATACATGGGGACTTACATCCAGGACATATAATGGTAGATAACCAAGCA
AACGTCACAGGTCTCATAGACTGGACTGAAGCAACCCACTCCGACCCATCAATGGACTTTATGGGACACCATCGTGTATTCGACGACGAA
GGATTAGAGCAACTCATAACAGCATATGGTAAAGCTGGAGGTGAAATATGGCCACGAATGAAAGAGCATATAATAGAACTCAATGCAGTA
TTCCCAATGTTTATCGCTGAGTTTGCTATGGAATCAGGAGAATCGGCGTATGAAACGATGGCATTGAAAGAGTTAGGTATGAAAGAGTAG