NDM-5

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000467
CARD Short NameNDM-5
DefinitionNew Delhi beta-lactamase NDM-5.
AMR Gene FamilyNDM beta-lactamase
Drug Classcephalosporin, penicillin beta-lactam, carbapenem
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (65), Klebsiella pneumoniae (22), Enterobacteriaceae (8), Citrobacter freundii (3), Klebsiella (3), Pseudomonas aeruginosa (3), Enterobacterales (2), Proteus mirabilis (2)
GAZChina (19), New Delhi (15), India (3), Japan (3), Poland (2), Europe (2), Egypt (2)
FOODONwater food product (2)
ENVOhospital (10), wastewater treatment plant (2)
UBERONrenal system (4), urine (4), blood (3), feces (2)
Classification17 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic cefoxitin [Antibiotic]
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic ertapenem [Antibiotic]
+ NDM beta-lactamase [AMR Gene Family]
Sub-Term(s)
1 ontology terms | Show
+ BLI-489 [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesCitrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip, Klebsiella aerogenesp, Klebsiella michiganensisp+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabilisg+wgs, Salmonella entericap+wgs
Resistomes with Sequence VariantsCitrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip, Klebsiella aerogenesp, Klebsiella michiganensisp+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabilisg+wgs, Salmonella entericap+wgs
Publications

Hornsey M, et al. 2011. Antimicrob Agents Chemother 55(12): 5952-5954. A Novel Variant, NDM-5, of the New Delhi Metallo-beta-Lactamase in a Multidrug-Resistant Escherichia coli ST648 Isolate Recovered from a Patient in the United Kingdom. (PMID 21930874)

Resistomes

Prevalence of NDM-5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter freundii0%0.31%1.35%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%1.47%1.8%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Enterobacter asburiae0%0%0.79%0%0%
Enterobacter cloacae0%1.12%0.64%0%0%
Enterobacter hormaechei0%0.39%2.11%0%0%
Enterobacter roggenkampii0%0%8.63%0%0%
Escherichia coli0.07%0.88%4.31%0.13%0%
Escherichia fergusonii0%0.36%0%0%0%
Klebsiella aerogenes0%1.09%0%0%0%
Klebsiella michiganensis0%1.14%1.6%0%0%
Klebsiella pneumoniae0.06%0.29%1.85%0%0%
Klebsiella quasipneumoniae0%0.21%10.39%0%0%
Proteus mirabilis1.83%0%0.17%0%0%
Salmonella enterica0%0.22%0.01%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AEN03071.1|+|NDM-5 [Escherichia coli]
MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLLVD
TAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAAQHSLTFAANGWVEPATAPNFGPL
KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR


>gb|JN104597.1|+|115-927|NDM-5 [Escherichia coli]
ATGGAATTGCCCAATATTATGCACCCGGTCGCGAAGCTGAGCACCGCATTAGCCGCTGCATTGATGCTGAGCGGGTGCATGCCCGGTGAA
ATCCGCCCGACGATTGGCCAGCAAATGGAAACTGGCGACCAACGGTTTGGCGATCTGGTTTTCCGCCAGCTCGCACCGAATGTCTGGCAG
CACACTTCCTATCTCGACATGCCGGGTTTCGGGGCAGTCGCTTCCAACGGTTTGATCGTCAGGGATGGCGGCCGCGTGCTGTTGGTCGAT
ACCGCCTGGACCGATGACCAGACCGCCCAGATCCTCAACTGGATCAAGCAGGAGATCAACCTGCCGGTCGCGCTGGCGGTGGTGACTCAC
GCGCATCAGGACAAGATGGGCGGTATGGACGCGCTGCATGCGGCGGGGATTGCGACTTATGCCAATGCGTTGTCGAACCAGCTTGCCCCG
CAAGAGGGGCTGGTTGCGGCGCAACACAGCCTGACTTTCGCCGCCAATGGCTGGGTCGAACCAGCAACCGCGCCCAACTTTGGCCCGCTC
AAGGTATTTTACCCCGGCCCCGGCCACACCAGTGACAATATCACCGTTGGGATCGACGGCACCGACATCGCTTTTGGTGGCTGCCTGATC
AAGGACAGCAAGGCCAAGTCGCTCGGCAATCTCGGTGATGCCGACACTGAGCACTACGCCGCGTCAGCGCGCGCGTTTGGTGCGGCGTTC
CCCAAGGCCAGCATGATCGTGATGAGCCATTCCGCCCCCGATAGCCGCGCCGCAATCACTCATACGGCCCGCATGGCCGACAAGCTGCGC
TGA

Curator Acknowledgements
Curator Description Most Recent Edit