NDM-5

Download Sequences

Accession	ARO:3000467
CARD Short Name	NDM-5
Definition	New Delhi beta-lactamase NDM-5.
AMR Gene Family	NDM beta-lactamase
Drug Class	cephalosporin, penicillin beta-lactam, carbapenem
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^p+wgs, Citrobacter werkmanii^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs+gi, Escherichia fergusonii^p, Klebsiella aerogenes^p, Klebsiella michiganensis^p+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Proteus mirabilis^g+wgs, Salmonella enterica^p+wgs
Resistomes with Sequence Variants	Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^p+wgs, Citrobacter werkmanii^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs+gi, Escherichia fergusonii^p, Klebsiella aerogenes^p, Klebsiella michiganensis^p+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Proteus mirabilis^g+wgs, Salmonella enterica^p+wgs
Classification	17 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + antibiotic molecule + hydrolysis of beta-lactam antibiotic by metallo-beta-lactamase + beta-lactam antibiotic + beta-lactamase + class B (metallo-) beta-lactamase + cephalosporin [Drug Class] + third-generation cephalosporin + second-generation cephalosporin + subclass B1 (metallo-) beta-lactamase + penicillin beta-lactam [Drug Class] + carbapenem [Drug Class]
Parent Term(s)	4 ontology terms \| Show + confers_resistance_to_antibiotic cefoxitin [Antibiotic] + confers_resistance_to_antibiotic ceftazidime [Antibiotic] + confers_resistance_to_antibiotic ertapenem [Antibiotic] + NDM beta-lactamase [AMR Gene Family]
Sub-Term(s)	1 ontology terms \| Show + BLI-489 [Adjuvant] is_small_molecule_inhibitor
Publications	Hornsey M, et al. 2011. Antimicrob Agents Chemother 55(12): 5952-5954. A Novel Variant, NDM-5, of the New Delhi Metallo-beta-Lactamase in a Multidrug-Resistant Escherichia coli ST648 Isolate Recovered from a Patient in the United Kingdom. (PMID 21930874)

Resistomes

Prevalence of NDM-5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter freundii	0%	0.31%	1.35%	0%	0%
Citrobacter freundii	0%	0.31%	1.35%	0%	0%
Citrobacter koseri	0%	0%	0.9%	0%	0%
Citrobacter koseri	0%	0%	0.9%	0%	0%
Citrobacter portucalensis	0%	1.47%	1.8%	0%	0%
Citrobacter portucalensis	0%	1.47%	1.8%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Enterobacter asburiae	0%	0%	0.79%	0%	0%
Enterobacter asburiae	0%	0%	0.79%	0%	0%
Enterobacter cloacae	0%	1.12%	0.64%	0%	0%
Enterobacter cloacae	0%	1.12%	0.64%	0%	0%
Enterobacter hormaechei	0%	0.39%	2.11%	0%	0%
Enterobacter hormaechei	0%	0.39%	2.11%	0%	0%
Enterobacter roggenkampii	0%	0%	8.63%	0%	0%
Enterobacter roggenkampii	0%	0%	8.63%	0%	0%
Escherichia coli	0.07%	0.88%	4.3%	0.13%	0%
Escherichia coli	0.07%	0.88%	4.31%	0.13%	0%
Escherichia fergusonii	0%	0.36%	0%	0%	0%
Escherichia fergusonii	0%	0.36%	0%	0%	0%
Klebsiella aerogenes	0%	1.09%	0%	0%	0%
Klebsiella aerogenes	0%	1.09%	0%	0%	0%
Klebsiella michiganensis	0%	1.14%	1.6%	0%	0%
Klebsiella michiganensis	0%	1.14%	1.6%	0%	0%
Klebsiella pneumoniae	0.06%	0.29%	1.85%	0%	0%
Klebsiella pneumoniae	0.06%	0.29%	1.85%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	10.39%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	10.39%	0%	0%
Proteus mirabilis	1.83%	0%	0.17%	0%	0%
Proteus mirabilis	1.83%	0%	0.17%	0%	0%
Salmonella enterica	0%	0.22%	0.01%	0%	0%
Salmonella enterica	0%	0.22%	0.01%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|AEN03071.1|+|NDM-5 [Escherichia coli]
MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLLVD
TAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGLVAAQHSLTFAANGWVEPATAPNFGPL
KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR

>gb|JN104597.1|+|115-927|NDM-5 [Escherichia coli]
ATGGAATTGCCCAATATTATGCACCCGGTCGCGAAGCTGAGCACCGCATTAGCCGCTGCATTGATGCTGAGCGGGTGCATGCCCGGTGAA
ATCCGCCCGACGATTGGCCAGCAAATGGAAACTGGCGACCAACGGTTTGGCGATCTGGTTTTCCGCCAGCTCGCACCGAATGTCTGGCAG
CACACTTCCTATCTCGACATGCCGGGTTTCGGGGCAGTCGCTTCCAACGGTTTGATCGTCAGGGATGGCGGCCGCGTGCTGTTGGTCGAT
ACCGCCTGGACCGATGACCAGACCGCCCAGATCCTCAACTGGATCAAGCAGGAGATCAACCTGCCGGTCGCGCTGGCGGTGGTGACTCAC
GCGCATCAGGACAAGATGGGCGGTATGGACGCGCTGCATGCGGCGGGGATTGCGACTTATGCCAATGCGTTGTCGAACCAGCTTGCCCCG
CAAGAGGGGCTGGTTGCGGCGCAACACAGCCTGACTTTCGCCGCCAATGGCTGGGTCGAACCAGCAACCGCGCCCAACTTTGGCCCGCTC
AAGGTATTTTACCCCGGCCCCGGCCACACCAGTGACAATATCACCGTTGGGATCGACGGCACCGACATCGCTTTTGGTGGCTGCCTGATC
AAGGACAGCAAGGCCAAGTCGCTCGGCAATCTCGGTGATGCCGACACTGAGCACTACGCCGCGTCAGCGCGCGCGTTTGGTGCGGCGTTC
CCCAAGGCCAGCATGATCGTGATGAGCCATTCCGCCCCCGATAGCCGCGCCGCAATCACTCATACGGCCCGCATGGCCGACAAGCTGCGC
TGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

NDM-5

Prevalence: protein homolog model (view sequences)

Graph