MexF

Accession ARO:3000804
Synonym(s)mexB mexD
DefinitionMexF is the multidrug inner membrane transporter of the MexEF-OprN complex. mexF corresponds to 2 loci in Pseudomonas aeruginosa PAO1 (gene name: mexF/mexB) and 4 loci in Pseudomonas aeruginosa LESB58 (gene name: mexD/mexB).
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classdiaminopyrimidine antibiotic, phenicol antibiotic, fluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification15 ontology terms | Show
Parent Term(s)5 ontology terms | Show
Publications

Kohler T, et al. 1999. J Bacteriol 181(20): 6300-6305. Characterization of MexT, the regulator of the MexE-MexF-OprN multidrug efflux system of Pseudomonas aeruginosa. (PMID 10515918)

Resistomes

Prevalence of MexF among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter koseri0%0%0%
Enterobacter cloacae0%0%0%
Escherichia coli0%0%0%
Klebsiella pneumoniae0%0%0%
Pseudomonas aeruginosa0%0%0%
Serratia marcescens0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 2110


>gb|AAG05882.1|+|MexF [Pseudomonas aeruginosa PAO1]
MNFSQFFIQRPIFAAVLSLLILIGGAISLFQLPISEYPEVVPPTVVVRANFPGANPKVIGETVASPLEQAITGVENMLYMSSQSTSDGKL
TLTITFALGTDLDNAQVQVQNRVTRTEPKLPEEVTRLGITVDKASPDLTMVVHLTSPDNRYDMLYLSNYAVLNVKDELARLDGVGDVQLF
GLGDYSLRVWLDPNKVASRNLTATDVVNAIREQNRQVAAGTLGAPPAPSDTSFQLSINTQGRLVTEEEFENIIIRAGANGEITRLRDIAR
VELGSNQYALRSLLNNKPAVAIPIFQRPGSNAIEISNLVREKMAELKHSFPQGMDYSIVYDPTIFVRGSIEAVVHTLFEALVLVVLVVIL
FLQTWRASIIPLAAVPVSLIGTFAVMHMLGFSLNALSLFGLVLAIGIVVDDAIVVVENVERNIGLGLKPVEATKRAMREVTGPIIATALV
LCAVFIPTAFISGLTGQFYRQFALTIAISTVISAFNSLTLSPALAAVLLKGHHEPKDRFSVFLDKLLGSWLFRPFNRFFDRASHGYVGTV
NRVLRGSSIALLVYGGLMVLTYFGFSSTPTGFVPQQDKQYLVAFAQLPDAASLDRTEAVIKQMSEIALAQPGVADSVAFPGLSINGFTNS
PNSGIVFTPLKPFDERKDPSQSAGAIAAALNAKYADIQDAYIAIFPPPPVQGLGTIGGFRLQIEDRGNQGYEELFKQTQNIITKARALPE
LEPSSVFSSYQVNVPQIDADIDREKAKTHGVAISDIFDTLQVYLGSLYANDFNRFGRTYQVNVQAEQQFRLEPEQIGQLKVRNNLGEMVP
LASFIKVSDTSGPDRVMHYNGFITAELNGAPAAGYSSGQAQAAIEKLLKEELPNGMTYEWTELTYQQILAGNTALFVFPLCVLLAFLVLA
AQYESWSLPLAVILIVPMTLLSAITGVILAGSDNNIFTQIGLIVLVGLACKNAILIVEFAKDKQEEGMDRVAAVLEACRLRLRPILMTSI
AFIMGVVPLVISTGAGAEMRHAMGVAVFSGMIGVTFFGLLLTPVFYVLIRRFVENREARRAANDKGLPEVHA


>gb|AE004091.2|+|2810009-2813197|MexF [Pseudomonas aeruginosa PAO1]
ATGAATTTCTCCCAATTCTTCATCCAGCGGCCGATCTTCGCCGCGGTGCTGTCGCTGCTGATCCTGATTGGCGGCGCCATCTCCCTGTTC
CAGCTACCCATCAGCGAATACCCGGAAGTGGTGCCGCCGACCGTCGTGGTCCGCGCCAACTTCCCCGGCGCCAACCCGAAAGTCATCGGC
GAGACCGTCGCCTCTCCCCTTGAACAGGCGATCACCGGGGTGGAGAACATGCTCTACATGTCCTCCCAGTCGACCTCCGACGGCAAGCTG
ACCCTGACCATCACCTTCGCCCTCGGCACCGACCTGGACAACGCCCAGGTGCAGGTGCAGAACCGCGTCACCCGGACCGAGCCGAAGCTC
CCGGAAGAAGTGACCCGGCTCGGCATCACCGTCGACAAGGCCTCGCCCGACCTGACCATGGTCGTGCACCTGACCTCGCCGGATAACCGC
TACGACATGCTCTACCTGTCGAACTACGCGGTGCTCAACGTGAAGGACGAACTGGCCCGCCTCGACGGCGTCGGCGACGTCCAGTTGTTC
GGCCTCGGCGACTATTCGCTGCGCGTCTGGCTGGACCCGAACAAGGTCGCCTCGCGCAACCTCACCGCCACCGACGTGGTCAACGCCATC
CGCGAGCAGAACCGCCAGGTCGCCGCCGGCACCCTGGGCGCGCCGCCGGCGCCGAGCGATACCAGCTTCCAGTTGTCGATCAACACCCAG
GGTCGCCTGGTCACCGAGGAAGAGTTCGAGAACATCATCATCCGCGCCGGCGCCAACGGCGAGATCACCCGTCTGCGCGACATCGCCCGG
GTCGAGCTGGGCTCCAACCAGTACGCCCTGCGTTCGCTGCTGAACAACAAGCCGGCGGTGGCGATCCCGATCTTCCAGCGTCCCGGCTCG
AACGCCATCGAGATCTCCAACCTGGTGCGGGAGAAGATGGCCGAGCTGAAGCACAGCTTCCCGCAAGGCATGGACTACTCCATCGTCTAC
GACCCGACCATCTTCGTCCGCGGCTCCATCGAGGCGGTGGTGCACACCCTGTTCGAAGCCCTGGTGCTGGTGGTGCTGGTGGTGATCCTG
TTCCTGCAGACCTGGCGCGCCTCGATCATCCCGCTGGCCGCGGTGCCGGTGTCGCTGATCGGCACCTTCGCGGTGATGCACATGCTCGGC
TTCTCGCTCAACGCGCTGTCGCTGTTCGGCCTGGTGCTGGCCATCGGCATCGTGGTGGACGACGCCATCGTGGTGGTGGAGAACGTCGAG
CGCAACATCGGCCTCGGCCTCAAGCCGGTGGAAGCCACCAAGCGTGCCATGCGCGAGGTGACCGGGCCGATCATCGCCACGGCGCTGGTG
CTCTGCGCGGTGTTCATCCCGACCGCGTTCATCTCCGGCCTCACCGGGCAGTTCTACCGCCAGTTCGCCCTGACCATCGCGATCTCCACG
GTGATCTCGGCGTTCAACTCGCTGACCCTGTCGCCAGCGCTGGCGGCGGTCCTGCTCAAGGGCCACCACGAGCCGAAGGACCGCTTCTCG
GTGTTCCTCGACAAGCTCCTCGGCAGTTGGCTGTTCCGTCCGTTCAACCGTTTCTTCGACCGCGCCAGCCATGGCTACGTCGGCACGGTG
AACCGGGTCCTGCGCGGCAGCTCGATCGCCCTGCTGGTCTACGGCGGACTGATGGTGCTGACCTACTTCGGCTTCTCCAGCACGCCGACC
GGTTTCGTCCCGCAGCAGGACAAGCAGTACCTGGTGGCCTTCGCCCAGTTGCCCGACGCGGCCAGCCTGGACCGTACCGAGGCGGTGATC
AAGCAGATGTCCGAGATCGCCCTGGCGCAGCCCGGCGTGGCGGACTCGGTGGCCTTCCCCGGCCTGTCGATCAACGGCTTCACCAACAGC
CCGAACAGCGGCATCGTGTTCACCCCGCTGAAGCCGTTCGACGAGCGCAAGGACCCGAGCCAGTCGGCCGGGGCCATCGCCGCCGCGCTG
AACGCCAAGTACGCCGACATTCAGGACGCCTACATCGCGATCTTCCCGCCGCCGCCGGTACAGGGGCTGGGGACCATCGGCGGCTTCCGC
CTGCAGATCGAGGACCGTGGCAACCAGGGCTACGAGGAGCTGTTCAAGCAGACCCAGAACATCATCACCAAGGCCCGTGCGCTGCCTGAG
CTGGAACCCAGCTCGGTGTTCTCCAGCTACCAGGTCAACGTGCCGCAGATCGACGCCGACATCGACCGCGAGAAGGCCAAGACCCACGGC
GTGGCGATCAGCGACATCTTCGACACCCTGCAGGTCTACCTCGGCTCGCTGTACGCGAACGACTTCAACCGCTTCGGCCGTACCTATCAG
GTCAACGTCCAGGCCGAGCAGCAGTTCCGCCTCGAACCCGAGCAGATCGGCCAGCTGAAGGTGCGCAACAACCTCGGCGAGATGGTCCCG
CTGGCGTCCTTCATCAAGGTCAGCGACACCTCCGGTCCGGACCGTGTGATGCACTACAACGGCTTCATCACCGCCGAACTCAACGGCGCC
CCGGCCGCGGGCTACAGCTCCGGCCAGGCGCAGGCGGCGATCGAGAAGCTGCTGAAGGAGGAACTGCCCAACGGCATGACCTACGAGTGG
ACCGAGCTGACCTACCAGCAGATCCTCGCCGGCAATACCGCGCTGTTCGTCTTCCCGCTCTGCGTGCTGCTGGCCTTCCTCGTGCTGGCC
GCCCAGTACGAGAGCTGGAGCCTACCGCTGGCGGTGATCCTGATCGTGCCGATGACCCTGCTGTCGGCGATCACCGGGGTGATCCTGGCC
GGCAGCGACAACAACATCTTTACCCAGATCGGCCTGATCGTTCTGGTGGGGCTGGCGTGCAAGAACGCGATCCTGATCGTCGAGTTCGCC
AAGGACAAGCAGGAGGAAGGCATGGACCGCGTCGCCGCGGTGCTGGAAGCCTGCCGCCTGCGCCTGCGGCCGATCCTGATGACGTCCATC
GCCTTCATCATGGGTGTGGTGCCGCTGGTGATCTCCACCGGCGCCGGCGCCGAGATGCGCCATGCGATGGGCGTGGCGGTGTTCTCCGGG
ATGATCGGGGTGACCTTCTTCGGCCTGCTGCTGACGCCGGTGTTCTACGTCCTCATCCGCCGCTTCGTGGAGAACCGCGAAGCGCGCCGC
GCCGCCAACGACAAAGGCCTGCCAGAGGTGCATGCATGA