CTX-M-3

Download Sequences

Accession	ARO:3001866
Synonym(s)	CTX-M-133
CARD Short Name	CTX-M-3
Definition	CTX-M-3 is a beta-lactamase found in Citrobacter freundii.
AMR Gene Family	CTX-M beta-lactamase
Drug Class	penicillin beta-lactam, cephalosporin
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Aeromonas caviae^g+p+wgs, Aeromonas hydrophila^g, Aeromonas veronii^g+p, Citrobacter amalonaticus^wgs, Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^g+p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^p+wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Morganella morganii^g+wgs, Proteus mirabilis^g+wgs+gi, Providencia rettgeri^g+wgs, Pseudomonas aeruginosa^wgs, Raoultella planticola^p, Salmonella enterica^wgs, Serratia marcescens^p+wgs, Shigella flexneri^p+wgs, Shigella sonnei^p+wgs
Resistomes with Sequence Variants	Aeromonas caviae^g+p+wgs, Aeromonas hydrophila^g, Aeromonas veronii^g+p, Citrobacter amalonaticus^wgs, Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^g+p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^p+wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Morganella morganii^g+wgs, Proteus mirabilis^g+wgs+gi, Providencia rettgeri^g+wgs, Pseudomonas aeruginosa^wgs, Raoultella planticola^p, Salmonella enterica^wgs, Serratia marcescens^p+wgs, Shigella flexneri^p+wgs, Shigella sonnei^p+wgs
Classification	17 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + beta-lactam antibiotic + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + penicillin beta-lactam [Drug Class] + beta-lactamase + cephalosporin [Drug Class] + penicillin with extended spectrum + third-generation cephalosporin + second-generation cephalosporin + first-generation cephalosporin + class A beta-lactamase
Parent Term(s)	8 ontology terms \| Show + confers_resistance_to_antibiotic cefoxitin [Antibiotic] + confers_resistance_to_antibiotic cefazolin [Antibiotic] + confers_resistance_to_antibiotic ceftazidime [Antibiotic] + confers_resistance_to_antibiotic ceftriaxone [Antibiotic] + CTX-M beta-lactamase [AMR Gene Family] + confers_resistance_to_antibiotic ampicillin [Antibiotic] + confers_resistance_to_antibiotic cefixime [Antibiotic] + confers_resistance_to_antibiotic cefalotin [Antibiotic]
Sub-Term(s)	1 ontology terms \| Show + vaborbactam [Adjuvant] is_small_molecule_inhibitor
Publications	Gniadkowski M, et al. 1998. Antimicrob Agents Chemother 42(4): 827-832. Cefotaxime-resistant Enterobacteriaceae isolates from a hospital in Warsaw, Poland: identification of a new CTX-M-3 cefotaxime-hydrolyzing beta-lactamase that is closely related to the CTX-M-1/MEN-1 enzyme. (PMID 9559791) Tsang KK, et al. 2021. Microb Genom 7(1): Identifying novel β-lactamase substrate activity through in silico prediction of antimicrobial resistance. (PMID 33416461)

Resistomes

Prevalence of CTX-M-3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Aeromonas caviae	4.55%	1.3%	1.08%	0%	0%
Aeromonas caviae	4.55%	1.3%	1.08%	0%	0%
Aeromonas hydrophila	4.62%	0%	0%	0%	0%
Aeromonas hydrophila	4.62%	0%	0%	0%	0%
Aeromonas veronii	3.64%	1.54%	0%	0%	0%
Aeromonas veronii	3.64%	1.54%	0%	0%	0%
Citrobacter amalonaticus	0%	0%	1.82%	0%	0%
Citrobacter amalonaticus	0%	0%	1.82%	0%	0%
Citrobacter freundii	0%	0%	2.9%	0%	0%
Citrobacter freundii	0%	0%	2.9%	0%	0%
Citrobacter portucalensis	0%	0%	3.6%	0%	0%
Citrobacter portucalensis	0%	0%	3.6%	0%	0%
Enterobacter asburiae	0%	0%	2.37%	0%	0%
Enterobacter asburiae	0%	0%	2.37%	0%	0%
Enterobacter chengduensis	0%	0%	4%	0%	0%
Enterobacter chengduensis	0%	0%	4%	0%	0%
Enterobacter cloacae	0%	1.12%	1.6%	0%	0%
Enterobacter cloacae	0%	1.12%	1.6%	0%	0%
Enterobacter hormaechei	0%	0.39%	3.41%	0%	0%
Enterobacter hormaechei	0%	0.39%	3.41%	0%	0%
Enterobacter kobei	4.55%	1.38%	3.93%	0%	0%
Enterobacter kobei	4.55%	1.38%	3.93%	0%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%	0%
Escherichia coli	0.05%	0.08%	0.45%	0%	0%
Escherichia coli	0.05%	0.08%	0.45%	0%	0%
Escherichia fergusonii	0%	0.36%	6.52%	0%	0%
Escherichia fergusonii	0%	0.36%	6.52%	0%	0%
Klebsiella aerogenes	0%	0%	0.56%	0%	0%
Klebsiella aerogenes	0%	0%	0.56%	0%	0%
Klebsiella michiganensis	0%	1.14%	0.8%	0%	0%
Klebsiella michiganensis	0%	1.14%	0.8%	0%	0%
Klebsiella oxytoca	0%	0%	0.84%	0%	0%
Klebsiella oxytoca	0%	0%	0.84%	0%	0%
Klebsiella pneumoniae	0.18%	0.6%	1.5%	0%	0%
Klebsiella pneumoniae	0.18%	0.61%	1.52%	0%	0%
Klebsiella quasipneumoniae	0%	0.85%	3.68%	0%	0%
Klebsiella quasipneumoniae	0%	0.85%	3.68%	0%	0%
Morganella morganii	3.85%	0%	3.68%	0%	0%
Morganella morganii	3.85%	0%	3.07%	0%	0%
Proteus mirabilis	4.59%	0%	0.5%	7.41%	0%
Proteus mirabilis	4.59%	0%	0.5%	7.41%	0%
Providencia rettgeri	8.82%	0%	1.27%	0%	0%
Providencia rettgeri	8.82%	0%	1.27%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.03%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.03%	0%	0%
Raoultella planticola	0%	2.33%	0%	0%	0%
Raoultella planticola	0%	2.33%	0%	0%	0%
Salmonella enterica	0%	0%	0.01%	0%	0%
Salmonella enterica	0%	0%	0.01%	0%	0%
Serratia marcescens	0%	0.65%	0.13%	0%	0%
Serratia marcescens	0%	0.65%	0.13%	0%	0%
Shigella flexneri	0%	1.2%	0.78%	0%	0%
Shigella flexneri	0%	1.2%	0.78%	0%	0%
Shigella sonnei	0%	4.85%	0.51%	0%	0%
Shigella sonnei	0%	4.85%	0.51%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|CAA71321.1|+|CTX-M-3 [Citrobacter freundii]
MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKKSESE
PNLLNQRVEIKKSDLVNYNPIAEKHVNGTMSLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP
RDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQ
PKAESRRDVLASAAKIVTDGL

>gb|Y10278.1|+|1-876|CTX-M-3 [Citrobacter freundii]
ATGGTTAAAAAATCACTGCGCCAGTTCACGCTGATGGCGACGGCAACCGTCACGCTGTTGTTAGGAAGTGTGCCGCTGTATGCGCAAACG
GCGGACGTACAGCAAAAACTTGCCGAATTAGAGCGGCAGTCGGGAGGCAGACTGGGTGTGGCATTGATTAACACAGCAGATAATTCGCAA
ATACTTTATCGTGCTGATGAGCGCTTTGCGATGTGCAGCACCAGTAAAGTGATGGCCGCGGCCGCGGTGCTGAAGAAAAGTGAAAGCGAA
CCGAATCTGTTAAATCAGCGAGTTGAGATCAAAAAATCTGACCTTGTTAACTATAATCCGATTGCGGAAAAGCACGTCAATGGGACGATG
TCACTGGCTGAGCTTAGCGCGGCCGCGCTACAGTACAGCGATAACGTGGCGATGAATAAGCTGATTGCTCACGTTGGCGGCCCGGCTAGC
GTCACCGCGTTCGCCCGACAGCTGGGAGACGAAACGTTCCGTCTCGACCGTACCGAGCCGACGTTAAACACCGCCATTCCGGGCGATCCG
CGTGATACCACTTCACCTCGGGCAATGGCGCAAACTCTGCGGAATCTGACGCTGGGTAAAGCATTGGGCGACAGCCAACGGGCGCAGCTG
GTGACATGGATGAAAGGCAATACCACCGGTGCAGCGAGCATTCAGGCTGGACTGCCTGCTTCCTGGGTTGTGGGGGATAAAACCGGCAGC
GGTGACTATGGCACCACCAACGATATCGCGGTGATCTGGCCAAAAGATCGTGCGCCGCTGATTCTGGTCACTTACTTCACCCAGCCTCAA
CCTAAGGCAGAAAGCCGTCGCGATGTATTAGCGTCGGCGGCTAAAATCGTCACCGACGGTTTGTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

CTX-M-3

Prevalence: protein homolog model (view sequences)

Graph