CTX-M-3

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3001866
Synonym(s)CTX-M-133
CARD Short NameCTX-M-3
DefinitionCTX-M-3 is a beta-lactamase found in Citrobacter freundii.
AMR Gene FamilyCTX-M beta-lactamase
Drug Classazole antibiotic, penicillin beta-lactam, cephalosporin, imidazole antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (35), Klebsiella pneumoniae (24), Enterobacter cloacae (13), Serratia marcescens (10), Citrobacter freundii (7), Enterobacteriaceae (7), Salmonella enterica (3), Aeromonas hydrophila (2), Salmonella (2), Enterobacter (2)
GAZChina (6), Poland (5), Republic of China (5), Europe (4), [Former] State of Korea (3), South Africa (2), Japan (2), Belfast (2)
FOODONswine (2)
ENVOhospital (9)
UBERONblood (2)
Classification19 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic cefoxitin [Antibiotic]
+ confers_resistance_to_antibiotic cefazolin [Antibiotic]
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ CTX-M beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ confers_resistance_to_antibiotic cefixime [Antibiotic]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
Sub-Term(s)
1 ontology terms | Show
+ vaborbactam [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesAeromonas caviaeg+p+wgs, Aeromonas hydrophilag, Aeromonas veroniig+p, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeig+p+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+wgs, Proteus mirabilisg+wgs+gi, Providencia rettgerig+wgs, Pseudomonas aeruginosawgs, Raoultella planticolap, Salmonella entericawgs, Serratia marcescensp+wgs, Shigella flexnerip+wgs, Shigella sonneip+wgs
Resistomes with Sequence VariantsAeromonas caviaeg+p+wgs, Aeromonas hydrophilag, Aeromonas veroniig+p, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeig+p+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+wgs, Proteus mirabilisg+wgs+gi, Providencia rettgerig+wgs, Pseudomonas aeruginosawgs, Raoultella planticolap, Salmonella entericawgs, Serratia marcescensp+wgs, Shigella flexnerip+wgs, Shigella sonneip+wgs
Publications

Gniadkowski M, et al. 1998. Antimicrob Agents Chemother 42(4): 827-832. Cefotaxime-resistant Enterobacteriaceae isolates from a hospital in Warsaw, Poland: identification of a new CTX-M-3 cefotaxime-hydrolyzing beta-lactamase that is closely related to the CTX-M-1/MEN-1 enzyme. (PMID 9559791)

Tsang KK, et al. 2021. Microb Genom 7(1): Identifying novel β-lactamase substrate activity through in silico prediction of antimicrobial resistance. (PMID 33416461)

Resistomes

Prevalence of CTX-M-3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas caviae4.55%1.3%1.08%0%0%
Aeromonas hydrophila4.62%0%0%0%0%
Aeromonas veronii3.64%1.54%0%0%0%
Citrobacter amalonaticus0%0%1.82%0%0%
Citrobacter freundii0%0%2.9%0%0%
Citrobacter portucalensis0%0%3.6%0%0%
Enterobacter asburiae0%0%2.37%0%0%
Enterobacter chengduensis0%0%4%0%0%
Enterobacter cloacae0%1.12%1.6%0%0%
Enterobacter hormaechei0%0.39%3.41%0%0%
Enterobacter kobei4.55%1.38%3.93%0%0%
Enterobacter roggenkampii0%0%0.72%0%0%
Escherichia coli0.05%0.08%0.45%0%0%
Escherichia fergusonii0%0.36%6.52%0%0%
Klebsiella aerogenes0%0%0.56%0%0%
Klebsiella michiganensis0%1.14%0.8%0%0%
Klebsiella oxytoca0%0%0.84%0%0%
Klebsiella pneumoniae0.18%0.61%1.52%0%0%
Klebsiella quasipneumoniae0%0.85%3.68%0%0%
Morganella morganii3.85%0%3.68%0%0%
Proteus mirabilis4.59%0%0.5%7.41%0%
Providencia rettgeri8.82%0%1.27%0%0%
Pseudomonas aeruginosa0%0%0.03%0%0%
Raoultella planticola0%2.33%0%0%0%
Salmonella enterica0%0%0.01%0%0%
Serratia marcescens0%0.65%0.13%0%0%
Shigella flexneri0%1.2%0.78%0%0%
Shigella sonnei0%4.85%0.51%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|CAA71321.1|+|CTX-M-3 [Citrobacter freundii]
MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKKSESE
PNLLNQRVEIKKSDLVNYNPIAEKHVNGTMSLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP
RDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQ
PKAESRRDVLASAAKIVTDGL


>gb|Y10278.1|+|1-876|CTX-M-3 [Citrobacter freundii]
ATGGTTAAAAAATCACTGCGCCAGTTCACGCTGATGGCGACGGCAACCGTCACGCTGTTGTTAGGAAGTGTGCCGCTGTATGCGCAAACG
GCGGACGTACAGCAAAAACTTGCCGAATTAGAGCGGCAGTCGGGAGGCAGACTGGGTGTGGCATTGATTAACACAGCAGATAATTCGCAA
ATACTTTATCGTGCTGATGAGCGCTTTGCGATGTGCAGCACCAGTAAAGTGATGGCCGCGGCCGCGGTGCTGAAGAAAAGTGAAAGCGAA
CCGAATCTGTTAAATCAGCGAGTTGAGATCAAAAAATCTGACCTTGTTAACTATAATCCGATTGCGGAAAAGCACGTCAATGGGACGATG
TCACTGGCTGAGCTTAGCGCGGCCGCGCTACAGTACAGCGATAACGTGGCGATGAATAAGCTGATTGCTCACGTTGGCGGCCCGGCTAGC
GTCACCGCGTTCGCCCGACAGCTGGGAGACGAAACGTTCCGTCTCGACCGTACCGAGCCGACGTTAAACACCGCCATTCCGGGCGATCCG
CGTGATACCACTTCACCTCGGGCAATGGCGCAAACTCTGCGGAATCTGACGCTGGGTAAAGCATTGGGCGACAGCCAACGGGCGCAGCTG
GTGACATGGATGAAAGGCAATACCACCGGTGCAGCGAGCATTCAGGCTGGACTGCCTGCTTCCTGGGTTGTGGGGGATAAAACCGGCAGC
GGTGACTATGGCACCACCAACGATATCGCGGTGATCTGGCCAAAAGATCGTGCGCCGCTGATTCTGGTCACTTACTTCACCCAGCCTCAA
CCTAAGGCAGAAAGCCGTCGCGATGTATTAGCGTCGGCGGCTAAAATCGTCACCGACGGTTTGTAA

Curator Acknowledgements
Curator Description Most Recent Edit