CTX-M-3

Accession ARO:3001866
Synonym(s)CTX-M-133
DefinitionCTX-M-3 is a beta-lactamase found in Citrobacter freundii
AMR Gene FamilyCTX-M beta-lactamase
Drug Classcephalosporin
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesCitrobacter freundiiwgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Escherichia colip+wgs, Klebsiella aerogeneswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiiwgs, Proteus mirabilisg+wgs, Providencia rettgeriwgs, Pseudomonas aeruginosawgs, Salmonella entericawgs, Serratia marcescensp+wgs, Shigella flexnerip+wgs, Shigella sonneiwgs
Resistomes with Sequence VariantsCitrobacter freundiiwgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Escherichia colip+wgs, Klebsiella aerogeneswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiiwgs, Proteus mirabilisg+wgs, Providencia rettgeriwgs, Pseudomonas aeruginosap+wgs, Salmonella entericawgs, Serratia marcescensp+wgs, Shigella flexnerip+wgs, Shigella sonneiwgs
Classification13 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ CTX-M beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
Publications

Gniadkowski M, et al. 1998. Antimicrob Agents Chemother 42(4): 827-832. Cefotaxime-resistant Enterobacteriaceae isolates from a hospital in Warsaw, Poland: identification of a new CTX-M-3 cefotaxime-hydrolyzing beta-lactamase that is closely related to the CTX-M-1/MEN-1 enzyme. (PMID 9559791)

Resistomes

Prevalence of CTX-M-3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter freundii0%0%1.91%
Enterobacter asburiae0%0%2.38%
Enterobacter cloacae0%2.3%0.59%
Enterobacter hormaechei0%0.55%2.69%
Enterobacter kobei0%0%11.59%
Escherichia coli0%0.04%0.4%
Klebsiella aerogenes0%0%0.47%
Klebsiella oxytoca0%0%0.78%
Klebsiella pneumoniae0.4%0.2%1.18%
Morganella morganii0%0%1.79%
Proteus mirabilis2.38%0%0.56%
Providencia rettgeri0%0%3.12%
Pseudomonas aeruginosa0%1.92%0.04%
Salmonella enterica0%0%0.01%
Serratia marcescens0%1.14%0.18%
Shigella flexneri0%2.63%0.83%
Shigella sonnei0%0%0.08%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|CAA71321.1|+|CTX-M-3 [Citrobacter freundii]
MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKKSESE
PNLLNQRVEIKKSDLVNYNPIAEKHVNGTMSLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP
RDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQ
PKAESRRDVLASAAKIVTDGL


>gb|Y10278|+|1-876|CTX-M-3 [Citrobacter freundii]
ATGGTTAAAAAATCACTGCGCCAGTTCACGCTGATGGCGACGGCAACCGTCACGCTGTTGTTAGGAAGTGTGCCGCTGTATGCGCAAACG
GCGGACGTACAGCAAAAACTTGCCGAATTAGAGCGGCAGTCGGGAGGCAGACTGGGTGTGGCATTGATTAACACAGCAGATAATTCGCAA
ATACTTTATCGTGCTGATGAGCGCTTTGCGATGTGCAGCACCAGTAAAGTGATGGCCGCGGCCGCGGTGCTGAAGAAAAGTGAAAGCGAA
CCGAATCTGTTAAATCAGCGAGTTGAGATCAAAAAATCTGACCTTGTTAACTATAATCCGATTGCGGAAAAGCACGTCAATGGGACGATG
TCACTGGCTGAGCTTAGCGCGGCCGCGCTACAGTACAGCGATAACGTGGCGATGAATAAGCTGATTGCTCACGTTGGCGGCCCGGCTAGC
GTCACCGCGTTCGCCCGACAGCTGGGAGACGAAACGTTCCGTCTCGACCGTACCGAGCCGACGTTAAACACCGCCATTCCGGGCGATCCG
CGTGATACCACTTCACCTCGGGCAATGGCGCAAACTCTGCGGAATCTGACGCTGGGTAAAGCATTGGGCGACAGCCAACGGGCGCAGCTG
GTGACATGGATGAAAGGCAATACCACCGGTGCAGCGAGCATTCAGGCTGGACTGCCTGCTTCCTGGGTTGTGGGGGATAAAACCGGCAGC
GGTGACTATGGCACCACCAACGATATCGCGGTGATCTGGCCAAAAGATCGTGCGCCGCTGATTCTGGTCACTTACTTCACCCAGCCTCAA
CCTAAGGCAGAAAGCCGTCGCGATGTATTAGCGTCGGCGGCTAAAATCGTCACCGACGGTTTGTAA