NDM-9

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002359
CARD Short NameNDM-9
DefinitionNDM-9 is a beta-lactamase found in Klebsiella pneumoniae.
AMR Gene FamilyOXA-48-like beta-lactamase, OXA-1-like beta-lactamase, CMY beta-lactamase, KPC beta-lactamase, NDM beta-lactamase, VIM beta-lactamase, IMP beta-lactamase, CTX-M beta-lactamase, SHV beta-lactamase
Drug Classpenicillin beta-lactam, azole antibiotic, cephalosporin, imidazole antibiotic, carbapenem, monobactam
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (2), Klebsiella pneumoniae (2)
GAZ
FOODON
ENVO
UBERON
Classification73 ontology terms | Show
+ process or component of antibiotic biology or chemistry
+ mechanism of antibiotic resistance
+ determinant of antibiotic resistance
+ antibiotic molecule
+ antibiotic inactivation [Resistance Mechanism]
+ antibiotic inactivation enzyme
+ hydrolysis of antibiotic conferring resistance
+ beta-lactam antibiotic
+ hydrolysis of beta-lactam antibiotic by serine beta-lactamase
+ penicillin beta-lactam [Drug Class]
+ beta-lactamase
+ beta-lactamase resistant penicillin
+ hydrolysis of beta-lactam antibiotic by metallo-beta-lactamase
+ class C beta-lactamase
+ resistance-modifying agents
+ azole antibiotic [Drug Class]
+ inhibitor of antibiotic resistance mechanism
+ CMY-LAT-MOX beta-lactamase
+ class A beta-lactamase
+ class D beta-lactamase
+ class B (metallo-) beta-lactamase
+ oxacillin [Antibiotic]
+ cephalosporin [Drug Class]
+ penicillin with extended spectrum
+ third-generation cephalosporin [Drug Subclass]
+ second-generation cephalosporin [Drug Subclass]
+ first-generation cephalosporin [Drug Subclass]
+ imidazole antibiotic [Drug Class]
+ subclass B1 (metallo-) beta-lactamase
+ SHV-LEN beta-lactamase
+ CMY-MOX beta-lactamase
+ CMY-LAT beta-lactamase
+ beta-lactamase inhibitor
+ OXA beta-lactamase
+ carbapenem [Drug Class]
+ monobactam [Drug Class]
+ OXA-48-like beta-lactamase [AMR Gene Family]
+ OXA-1-like beta-lactamase [AMR Gene Family]
+ metallo-beta-lactamase inhibitor
+ serine beta-lactamase inhibitor
+ temocillin [Antibiotic]
+ cefalotin [Antibiotic]
+ cefixime [Antibiotic]
+ ampicillin [Antibiotic]
+ CMY beta-lactamase [AMR Gene Family]
+ KPC beta-lactamase [AMR Gene Family]
+ NDM beta-lactamase [AMR Gene Family]
+ VIM beta-lactamase [AMR Gene Family]
+ IMP beta-lactamase [AMR Gene Family]
+ CTX-M beta-lactamase [AMR Gene Family]
+ SHV beta-lactamase [AMR Gene Family]
+ piperacillin [Antibiotic]
+ ertapenem [Antibiotic]
+ amoxicillin [Antibiotic]
+ ceftriaxone [Antibiotic]
+ ceftazidime [Antibiotic]
+ cefazolin [Antibiotic]
+ cefoxitin [Antibiotic]
+ fourth-generation cephalosporin [Drug Subclass]
+ unclassified metallo-beta-lactamase inhibitor
+ boronic acid beta-lactamase inhibitor
+ KPC-2
+ VIM-2
+ IMP-1
+ CMY-2
+ CTX-M-15
+ OXA-48
+ OXA-1
+ SHV-5
+ NDM-2
+ taniborbactam [Adjuvant]
+ antibiotic mixture
+ cefepime [Antibiotic]
Parent Term(s)2 ontology terms | Show
+ NDM beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic cefepime-taniborbactam [Antibiotic+Adjuvant]
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Escherichia colip+wgs, Klebsiella aerogenesp, Klebsiella pneumoniaewgs, Salmonella entericag+p
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Escherichia colip+wgs, Klebsiella aerogenesp, Klebsiella pneumoniaewgs, Salmonella entericag+p
Publications

Wang X, et al. 2014. Int J Antimicrob Agents 44(1): 90-91. Novel NDM-9 metallo-beta-lactamase identified from a ST107 Klebsiella pneumoniae strain isolated in China. (PMID 24913967)

Resistomes

Prevalence of NDM-9 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.01%0%0%
Escherichia coli0%0.01%0.31%0%0%
Klebsiella aerogenes0%1.09%0%0%0%
Klebsiella pneumoniae0%0%0.06%0%0%
Salmonella enterica0.06%0.05%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AGU91756.1|+|NDM-9 [Klebsiella pneumoniae subsp. pneumoniae]
MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVD
TAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQKGMVAAQHSLTFAANGWVEPATAPNFGPL
KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR


>gb|KC999080.2|+|380-1192|NDM-9 [Klebsiella pneumoniae subsp. pneumoniae]
ATGGAATTGCCCAATATTATGCACCCGGTCGCGAAGCTGAGCACCGCATTAGCCGCTGCATTGATGCTGAGCGGGTGCATGCCCGGTGAA
ATCCGCCCGACGATTGGCCAGCAAATGGAAACTGGCGACCAACGGTTTGGCGATCTGGTTTTCCGCCAGCTCGCACCGAATGTCTGGCAG
CACACTTCCTATCTCGACATGCCGGGTTTCGGGGCAGTCGCTTCCAACGGTTTGATCGTCAGGGATGGCGGCCGCGTGCTGGTGGTCGAT
ACCGCCTGGACCGATGACCAGACCGCCCAGATCCTCAACTGGATCAAGCAGGAGATCAACCTGCCGGTCGCGCTGGCGGTGGTGACTCAC
GCGCATCAGGACAAGATGGGCGGTATGGACGCGCTGCATGCGGCGGGGATTGCGACTTATGCCAATGCGTTGTCGAACCAGCTTGCCCCG
CAAAAGGGGATGGTTGCGGCGCAACACAGCCTGACTTTCGCCGCCAATGGCTGGGTCGAACCAGCAACCGCGCCCAACTTTGGCCCGCTC
AAGGTATTTTACCCCGGCCCCGGCCACACCAGTGACAATATCACCGTTGGGATCGACGGCACCGACATCGCTTTTGGTGGCTGCCTGATC
AAGGACAGCAAGGCCAAGTCGCTCGGCAATCTCGGTGATGCCGACACTGAGCACTACGCCGCGTCAGCGCGCGCGTTTGGTGCGGCGTTC
CCCAAGGCCAGCATGATCGTGATGAGCCATTCCGCCCCCGATAGCCGCGCCGCAATCACTCATACGGCCCGCATGGCCGACAAGCTGCGC
TGA

Curator Acknowledgements
Curator Description Most Recent Edit