vgaC

Accession ARO:3002831
CARD Short NamevgaC
DefinitionvgaC is an ABC-F subfamily protein expressed in staphylococci that confers resistance to streptogramin A antibiotics and related compounds. It is associated with plasmid DNA.
AMR Gene Familyvga-type ABC-F protein
Drug Classstreptogramin antibiotic, pleuromutilin antibiotic, lincosamide antibiotic, streptogramin A antibiotic
Resistance Mechanismantibiotic target protection
Resistomes with Perfect MatchesStaphylococcus aureuswgs
Resistomes with Sequence VariantsStaphylococcus aureuswgs
Classification11 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ vga-type ABC-F protein [AMR Gene Family]
+ confers_resistance_to_antibiotic virginiamycin M1 [Antibiotic]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ confers_resistance_to_antibiotic tiamulin [Antibiotic]
+ confers_resistance_to_antibiotic valnemulin [Antibiotic]
Publications

Kadlec K, et al. 2010. J. Antimicrob. Chemother. 65(12):2692-3 Small plasmids carrying vga(A) or vga(C) genes mediate resistance to lincosamides, pleuromutilins and streptogramin A antibiotics in methicillin-resistant Staphylococcus aureus ST398 from swine. (PMID 20876620)

Kadlec K and Schwarz S. 2009. Antimicrob Agents Chemother 53(8): 3589-3591. Novel ABC transporter gene, vga(C), located on a multiresistance plasmid from a porcine methicillin-resistant Staphylococcus aureus ST398 strain. (PMID 19470508)

Resistomes

Prevalence of vgaC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Staphylococcus aureus0%0%0.01%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 1000


>gb|CBL58195.1|+|vgaC [Staphylococcus aureus]
MVLLEAKNIKHYIKDRLLLKIDELKIEHNDRIGLVGVNGSGKTTLLNILAEKFIPDEGTITPYAQSEILPQLKKTDAAKSGGEITQEYIQ
QTLNSAPALLLADEPTTNLDTDHIEWVEKKLKRWQGAFVLVSHDREFLDALCSVIWELEDGEITEYKGNYSDYLKQKEVEKQQQQSTYEK
YEKEKKQLEKAIQLKEEKAQRATKKPKNLSASERRIKGSKPYFAKKQKKLHKTAGALETRVEKLEKVEKIKDQPPIKMDLPNERNLKNRV
IIRVEDLEGLVPKQLLWKKATFQIYGGDKLAIIGPNGSGKTTLVKKIITQENGVTISPSVKIGYFSQNLMTLDVNKSILENVQNSSKQEE
SLIRTVLARMHFFDEDVYKPVHVLSGGERVKVALTKLLVSDINTLVLDEPTNYLDTEALKALENLLNEYTGSIIFVSHDRTFTENIATRI
LEIRNKKIEIFDGTYQQFKNRSTKKERDFQQEEQLLLDTKISEVLSRLSMEPSQALEKEFQNLLKEKSKLKE


>gb|FN806792.1|+|101-1669|vgaC [Staphylococcus aureus]
ATGGTTTTACTAGAGGCCAAAAATATAAAACACTACATCAAAGATCGCTTATTATTAAAGATTGATGAATTAAAAATTGAACATAATGAC
CGGATTGGCTTGGTAGGTGTAAATGGAAGTGGAAAAACAACTTTGTTAAATATCCTTGCTGAAAAATTTATTCCTGACGAGGGGACAATC
ACGCCGTATGCCCAGAGTGAGATATTGCCACAGTTAAAAAAGACCGATGCGGCAAAAAGTGGGGGCGAAATTACTCAGGAATATATTCAA
CAAACGTTAAATAGTGCTCCAGCTCTTTTATTAGCAGACGAACCGACGACCAATCTAGATACAGATCATATCGAATGGGTTGAAAAAAAA
TTGAAGCGTTGGCAGGGGGCCTTCGTTCTTGTTTCCCATGACCGAGAATTTTTAGACGCTCTGTGTTCTGTTATTTGGGAACTGGAAGAT
GGTGAAATAACGGAGTACAAGGGCAATTATAGTGATTATCTCAAGCAAAAAGAAGTAGAAAAGCAACAACAACAATCCACATATGAAAAA
TATGAAAAAGAAAAAAAACAGCTGGAGAAAGCAATCCAACTAAAAGAAGAAAAGGCCCAACGAGCAACTAAAAAGCCTAAAAATTTATCT
GCTTCTGAGAGACGAATAAAGGGATCGAAGCCTTACTTCGCAAAAAAACAGAAAAAACTGCATAAAACTGCAGGTGCTCTTGAAACAAGA
GTAGAGAAATTAGAAAAAGTAGAGAAAATAAAAGATCAGCCACCTATTAAAATGGATTTACCAAATGAAAGAAATCTTAAAAATCGTGTG
ATTATTCGGGTTGAGGATCTAGAAGGACTTGTTCCCAAGCAGTTACTTTGGAAAAAGGCAACTTTTCAAATTTATGGTGGGGACAAACTA
GCTATCATAGGACCCAATGGTAGTGGAAAAACAACTTTAGTTAAAAAAATAATAACTCAAGAAAATGGTGTCACTATTTCTCCGTCTGTT
AAGATCGGTTACTTTAGTCAGAATCTAATGACGCTAGATGTAAACAAATCTATTTTAGAGAACGTTCAAAATTCTTCGAAACAAGAAGAA
TCACTGATTCGAACGGTACTAGCTAGAATGCATTTCTTTGATGAAGATGTATACAAACCTGTGCATGTGCTAAGCGGTGGTGAAAGAGTA
AAAGTTGCACTGACAAAACTATTAGTGAGCGATATCAATACACTCGTTTTAGATGAACCAACGAATTACTTGGATACGGAAGCACTCAAA
GCATTAGAAAACCTCTTGAATGAATATACGGGAAGTATTATTTTTGTTTCTCATGATCGTACCTTTACCGAAAATATCGCTACTCGAATT
TTAGAAATACGTAATAAAAAAATTGAGATATTTGATGGGACGTACCAACAATTCAAAAATAGATCTACTAAAAAGGAACGGGATTTTCAG
CAAGAAGAGCAGTTACTACTAGATACAAAGATATCCGAAGTACTTAGCCGCTTAAGTATGGAACCTTCCCAAGCTTTGGAAAAAGAATTT
CAAAACCTCCTAAAAGAAAAAAGTAAGTTAAAGGAGTAA