PvrR

Accession ARO:3003688
CARD Short NamePvrR
DefinitionPvrR is a response regulator that controls the conversion between antibiotic-resistant and antibiotic-susceptible forms of Pseudomonas aeruginosa biofilms through porin deletion/gene absence.
AMR Gene Familyphenotypic variant regulator
Drug Classpenam, aminoglycoside antibiotic, tetracycline antibiotic
Resistance Mechanismresistance by absence
Classification10 ontology terms | Show
Parent Term(s)7 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic carbenicillin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin A [Antibiotic]
+ phenotypic variant regulator [AMR Gene Family]
Publications

Drenkard E, et al. 2002. Nature 416(6882):740-3 Pseudomonas biofilm formation and antibiotic resistance are linked to phenotypic variation. (PMID 11961556)

Resistomes

Prevalence of PvrR among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein knockout model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
No prevalence data


Detection Models

Model Type: protein knockout model

Model Definition: Protein Knockout Models (PKM) reflect resistance by the absence of a gene product, most often deletion of a gene involved in antibiotic import, such as Vibrio cholerae OmpT. Like Protein Homolog Models (PHMs), PKMs include a reference sequence and a bitscore cut-off for detection using BLASTP but instead are designed to only report lack of detection under Perfect or Strict criteria. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software.

Bit-score Cut-off (blastP): 750


>gb|AAM15533.1|+|PvrR [Pseudomonas aeruginosa]
MSWKSYRVLVVEDQPFQREYLLNLFRERGVQYLVGAGDGAEALRCLKQDRFDLILSDLMMPGMDGIQMILQLPYLKHRPKLALMSSSSQR
MMLSASRVAQSLGLSVIDLLPKPTLPKAIGQLLEHLERCLRQKLEPETDETPHGRTALLDALHNEQLVTWFQAKKSLHTGRIVGAEALIR
WSHPQHGLLLPSCFMSDVDATGLHEALLWRVLEQTLNAQESWRRAGYEIPVSVNLPPHLLDNQELPDRLYEYVGARGACTSSLCFELTES
SVTTLSSNYYAGACRLRMKGFGLAQDDFGQGYSSFYNLVTTPFTELKIDRSLVQGCVEDNGLNAAVISCIELGHRLNLDVVAEGVETCEE
LNLLRRLGCDRAQGFLISKAVSAREFERQLREDGPSLLV


>gb|AF482691.2|+|2797-3996|PvrR [Pseudomonas aeruginosa]
ATGAGCTGGAAATCCTATCGGGTGCTGGTGGTCGAAGATCAGCCGTTTCAGCGCGAATACCTGCTCAACCTGTTTCGCGAGCGCGGCGTG
CAGTACCTGGTAGGTGCCGGCGACGGCGCGGAGGCGTTGCGCTGCCTGAAGCAGGACAGGTTCGACCTGATCCTCAGCGATCTGATGATG
CCGGGCATGGATGGTATCCAAATGATCCTGCAACTGCCGTATCTCAAGCATCGTCCGAAGCTGGCGCTGATGAGCTCCTCGTCGCAGCGG
ATGATGCTCAGTGCCAGCCGGGTCGCCCAGAGTCTCGGCTTGTCGGTAATCGACCTGTTGCCCAAGCCGACTCTGCCCAAGGCCATCGGC
CAACTTCTGGAACACCTGGAAAGATGCCTCAGGCAGAAGCTGGAGCCGGAAACCGACGAGACTCCGCATGGGCGCACGGCGTTGCTGGAT
GCCCTGCATAACGAGCAACTGGTGACCTGGTTCCAGGCTAAGAAATCCCTCCACACCGGGCGCATAGTCGGCGCCGAGGCGTTGATACGC
TGGAGCCACCCGCAGCATGGCCTGTTGCTGCCCAGCTGTTTCATGAGTGATGTCGACGCTACCGGTCTGCACGAGGCGTTGCTCTGGCGC
GTGCTCGAACAGACCCTGAACGCCCAGGAATCGTGGCGCAGGGCGGGTTACGAGATTCCGGTTTCGGTGAATCTGCCGCCGCACCTGCTC
GATAACCAGGAACTTCCGGATCGACTCTATGAGTACGTCGGCGCTCGCGGGGCTTGTACCAGCTCACTATGTTTCGAGTTGACCGAGAGC
AGTGTCACAACTCTGTCAAGTAACTACTATGCAGGTGCCTGTCGCTTGCGCATGAAAGGGTTCGGATTGGCCCAGGACGACTTTGGCCAG
GGTTACAGCTCGTTCTATAACCTGGTCACGACGCCTTTCACGGAGCTGAAGATCGACCGCTCCCTAGTCCAGGGATGCGTAGAGGATAAC
GGCCTCAATGCAGCTGTCATCAGTTGTATTGAGTTGGGTCACCGCCTGAATCTCGACGTGGTGGCCGAAGGCGTGGAGACCTGCGAGGAA
CTGAATCTTCTTCGTCGTCTTGGCTGCGACCGGGCGCAGGGTTTCCTGATTTCTAAGGCAGTGTCTGCTCGTGAGTTCGAGCGGCAGTTA
AGGGAGGACGGCCCCAGCCTCCTTGTTTAA