MCR-1.1

Download Sequences

Accession	ARO:3003689
Synonym(s)	MCR-1
CARD Short Name	MCR-1.1
Definition	MCR-1 is a plasmid-borne phosphoethanolamine transferase that interferes with binding of colistin to the cell membrane via addition of phosphoethanolamine to lipid A, resulting reduction in negative charge of the cell membrane.
AMR Gene Family	MCR phosphoethanolamine transferase
Drug Class	peptide antibiotic
Resistance Mechanism	antibiotic target alteration
Resistomes with Perfect Matches	Acinetobacter pittii^wgs, Citrobacter freundii^wgs, Citrobacter youngae^wgs, Enterobacter hormaechei^wgs, Escherichia albertii^wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^p+wgs, Klebsiella aerogenes^wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^wgs, Morganella morganii^wgs, Salmonella enterica^g+p+wgs, Vibrio parahaemolyticus^wgs
Resistomes with Sequence Variants	Acinetobacter pittii^wgs, Citrobacter freundii^wgs, Citrobacter youngae^wgs, Enterobacter hormaechei^wgs, Escherichia albertii^wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^p+wgs, Klebsiella aerogenes^wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^wgs, Morganella morganii^wgs, Salmonella enterica^g+p+wgs, Vibrio parahaemolyticus^wgs
Classification	14 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + peptide antibiotic [Drug Class] + mechanism of antibiotic resistance + lipopeptide antibiotic + antibiotic target alteration [Resistance Mechanism] + charge alteration conferring antibiotic resistance + determinant of antibiotic resistance + polymyxin antibiotic + gene altering cell wall charge + colistin + phosphoethanolamine transferase conferring colistin resistance + colistin B [Antibiotic] + colistin A [Antibiotic]
Parent Term(s)	3 ontology terms \| Show + confers_resistance_to_antibiotic colistin A [Antibiotic] + confers_resistance_to_antibiotic colistin B [Antibiotic] + MCR phosphoethanolamine transferase [AMR Gene Family]
Sub-Term(s)	13 ontology terms \| Show + MCR-1.4 evolutionary_variant_of + MCR-1.6 evolutionary_variant_of + MCR-1.12 evolutionary_variant_of + MCR-1.2 evolutionary_variant_of + MCR-1.7 evolutionary_variant_of + MCR-1.11 evolutionary_variant_of + MCR-1.13 evolutionary_variant_of + MCR-1.3 evolutionary_variant_of + MCR-1.5 evolutionary_variant_of + MCR-1.9 evolutionary_variant_of + MCR-1.8 evolutionary_variant_of + MCR-1.33 evolutionary_variant_of + pterostilbene [Adjuvant] is_small_molecule_inhibitor
Publications	Liu YY, et al. 2015. Lancet Infect Dis : Emergence of plasmid-mediated colistin resistance mechanism MCR-1 in animals and human beings in China: a microbiological and molecular biological study. (PMID 26603172)

Resistomes

Prevalence of MCR-1.1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter pittii	0%	0%	0.28%	0%	0%
Acinetobacter pittii	0%	0%	0.28%	0%	0%
Citrobacter freundii	0%	0%	0.19%	0%	0%
Citrobacter freundii	0%	0%	0.19%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Enterobacter hormaechei	0%	0%	0.09%	0%	0%
Enterobacter hormaechei	0%	0%	0.09%	0%	0%
Escherichia albertii	0%	0%	1.29%	0%	0%
Escherichia albertii	0%	0%	1.29%	0%	0%
Escherichia coli	0.83%	0.93%	6.76%	0%	0%
Escherichia coli	0.83%	0.92%	6.71%	0%	0%
Escherichia fergusonii	0%	2.14%	31.52%	0%	0%
Escherichia fergusonii	0%	2.14%	31.52%	0%	0%
Klebsiella aerogenes	0%	0%	2.26%	0%	0%
Klebsiella aerogenes	0%	0%	2.26%	0%	0%
Klebsiella pneumoniae	0.06%	0.1%	0.57%	0%	0%
Klebsiella pneumoniae	0.06%	0.12%	0.57%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.26%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.26%	0%	0%
Morganella morganii	0%	0%	1.23%	0%	0%
Morganella morganii	0%	0%	1.23%	0%	0%
Salmonella enterica	0.19%	1.86%	0.76%	0%	0%
Salmonella enterica	0.19%	1.86%	0.76%	0%	0%
Vibrio parahaemolyticus	0%	0%	0.05%	0%	0%
Vibrio parahaemolyticus	0%	0%	0.05%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 1000

Protein
DNA

>gb|AKF16168.1|+|MCR-1.1 [Escherichia coli]
MMQHTSVWYRRSVSPFVLVASVAVFLTATANLTFFDKISQTYPIADNLGFVLTIAVVLFGAMLLITTLLSSYRYVLKPVLILLLIMGAVT
SYFTDTYGTVYDTTMLQNALQTDQAETKDLLNAAFIMRIIGLGVLPSLLVAFVKVDYPTWGKGLMRRLGLIVASLALILLPVVAFSSHYA
SFFRVHKPLRSYVNPIMPIYSVGKLASIEYKKASAPKDTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKID
GVTNFSNVTSCGTSTAYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNP
YNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYDNALLATDDFIAQSIQWLQ
THSNAYDVSMLYVSDHGESLGENGVYLHGMPNAFAPKEQRSVPAFFWTDKQTGITPMATDTVLTHDAITPTLLKLFDVTADKVKDRTAFI
R

>gb|KP347127.1|+|22413-24038|MCR-1.1 [Escherichia coli]
ATGATGCAGCATACTTCTGTGTGGTACCGACGCTCGGTCAGTCCGTTTGTTCTTGTGGCGAGTGTTGCCGTTTTCTTGACCGCGACCGCC
AATCTTACCTTTTTTGATAAAATCAGCCAAACCTATCCCATCGCGGACAATCTCGGCTTTGTGCTGACGATCGCTGTCGTGCTCTTTGGC
GCGATGCTACTGATCACCACGCTGTTATCATCGTATCGCTATGTGCTAAAGCCTGTGTTGATTTTGCTATTAATCATGGGCGCGGTGACC
AGTTATTTTACTGACACTTATGGCACGGTCTATGATACGACCATGCTCCAAAATGCCCTACAGACCGACCAAGCCGAGACCAAGGATCTA
TTAAACGCAGCGTTTATCATGCGTATCATTGGTTTGGGTGTGCTACCAAGTTTGCTTGTGGCTTTTGTTAAGGTGGATTATCCGACTTGG
GGCAAGGGTTTGATGCGCCGATTGGGCTTGATCGTGGCAAGTCTTGCGCTGATTTTACTGCCTGTGGTGGCGTTCAGCAGTCATTATGCC
AGTTTCTTTCGCGTGCATAAGCCGCTGCGTAGCTATGTCAATCCGATCATGCCAATCTACTCGGTGGGTAAGCTTGCCAGTATTGAGTAT
AAAAAAGCCAGTGCGCCAAAAGATACCATTTATCACGCCAAAGACGCGGTACAAGCAACCAAGCCTGATATGCGTAAGCCACGCCTAGTG
GTGTTCGTCGTCGGTGAGACGGCACGCGCCGATCATGTCAGCTTCAATGGCTATGAGCGCGATACTTTCCCACAGCTTGCCAAGATCGAT
GGCGTGACCAATTTTAGCAATGTCACATCGTGCGGCACATCGACGGCGTATTCTGTGCCGTGTATGTTCAGCTATCTGGGCGCGGATGAG
TATGATGTCGATACCGCCAAATACCAAGAAAATGTGCTGGATACGCTGGATCGCTTGGGCGTAAGTATCTTGTGGCGTGATAATAATTCG
GACTCAAAAGGCGTGATGGATAAGCTGCCAAAAGCGCAATTTGCCGATTATAAATCCGCGACCAACAACGCCATCTGCAACACCAATCCT
TATAACGAATGCCGCGATGTCGGTATGCTCGTTGGCTTAGATGACTTTGTCGCTGCCAATAACGGCAAAGATATGCTGATCATGCTGCAC
CAAATGGGCAATCACGGGCCTGCGTATTTTAAGCGATATGATGAAAAGTTTGCCAAATTCACGCCAGTGTGTGAAGGTAATGAGCTTGCC
AAGTGCGAACATCAGTCCTTGATCAATGCTTATGACAATGCCTTGCTTGCCACCGATGATTTCATCGCTCAAAGTATCCAGTGGCTGCAG
ACGCACAGCAATGCCTATGATGTCTCAATGCTGTATGTCAGCGATCATGGCGAAAGTCTGGGTGAGAACGGTGTCTATCTACATGGTATG
CCAAATGCCTTTGCACCAAAAGAACAGCGCAGTGTGCCTGCATTTTTCTGGACGGATAAGCAAACTGGCATCACGCCAATGGCAACCGAT
ACCGTCCTGACCCATGACGCGATCACGCCGACATTATTAAAGCTGTTTGATGTCACCGCGGACAAAGTCAAAGACCGCACCGCATTCATC
CGCTGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

MCR-1.1

Prevalence: protein homolog model (view sequences)

Graph