salA

Accession ARO:3003749
DefinitionsalA is an ABC-F subfamily protein gene isolated from the chromosome of Staphylococcus sciuri conferring resistance to lincosamides and streptogramins.
AMR Gene FamilyABC-F ATP-binding cassette ribosomal protection protein
Drug Classtetracycline antibiotic, pleuromutilin antibiotic, phenicol antibiotic, streptogramin antibiotic, lincosamide antibiotic, oxazolidinone antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic target protection
Classification13 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_drug_class lincosamide antibiotic [Drug Class]
+ confers_resistance_to_drug_class streptogramin antibiotic [Drug Class]
+ confers_resistance_to_antibiotic pleuromutilin [Antibiotic]
+ ABC-F ATP-binding cassette ribosomal protection protein [AMR Gene Family]
Publications

Hot C, et al. 2014. Antimicrob. Agents Chemother. 58(6):3335-41 Characterization of sal(A), a novel gene responsible for lincosamide and streptogramin A resistance in Staphylococcus sciuri. (PMID 24687494)

Wendlandt S, et al. 2015. Vet. Microbiol. 177(3-4):353-8 Identification of ABC transporter genes conferring combined pleuromutilin-lincosamide-streptogramin A resistance in bovine methicillin-resistant Staphylococcus aureus and coagulase-negative staphylococci. (PMID 25891423)

Resistomes

Prevalence of salA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Staphylococcus aureus0%0%0.03%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1100


>gb|AGN74946|+|salA [Staphylococcus sciuri subsp. sciuri]
MLFLFEEKALEVEHKVLIPELTFSIEDHEHLAIVGVNGVGKSTLLKVIHQDQSVDSAMMEQDLTPYYDWTVMDYIIESYPEIAKIRLQLN
HTDMINKYIELDGYIIEGEIVTEAKKLGIKEEQLEQKISTLSGGEQTKVSFLKVKMSKASLLLIDEPTNHMDLEMKEWLTKAFKQEQRAI
LFVSHDRTFLNETPDAILELSLDGAKKYIGKYDKYKQQKDIEHETLKLQYEKQQKEQAAIEETIKKYKAWYQKAEQSASVRSPYQQKQLS
KLAKRFKSKEQQLNRKLDQEHIPNPHKKEKTFSIQHHNFKSHYLVQFNHVSFAYDNRKIFDDVSFYIKRNQNVIVEGRNGTGKSTLIKLI
LGELEPTKGDITVHPELEIGYFSQDFENLNMHHTVLDEILEIPEMKEADARTILASFYFDKDRINDVVETLSMGEKCRLQFVKLYFSNPH
IMILDEPTNYFDIGMQENIIQLIQSFQGSVLIVSHDNYFKSQIKDQTWTIKNHQMTHENVQVKDPINTESMKHHLKELEQYTDERNRETE
F


>gb|KC693025|+|1-1626|salA [Staphylococcus sciuri subsp. sciuri]
ATGCTATTTTTATTTGAAGAAAAAGCATTAGAAGTTGAACATAAAGTATTAATACCCGAGTTGACTTTTTCAATAGAGGACCATGAACAT
TTAGCAATCGTTGGTGTTAATGGTGTTGGAAAATCAACATTATTAAAAGTCATTCATCAAGATCAATCAGTTGATTCAGCGATGATGGAA
CAAGATTTAACACCTTATTATGATTGGACTGTTATGGATTATATAATTGAATCATATCCTGAAATCGCAAAGATTAGATTGCAACTTAAT
CATACAGATATGATTAATAAATATATTGAATTAGATGGATACATTATAGAAGGTGAAATCGTAACAGAAGCAAAAAAGCTCGGAATAAAA
GAGGAACAACTAGAACAGAAAATTTCTACTTTAAGTGGTGGAGAACAAACAAAAGTATCATTTTTAAAAGTGAAAATGTCTAAAGCATCA
TTACTATTAATCGATGAACCAACAAACCACATGGATTTAGAAATGAAGGAATGGTTGACGAAAGCTTTTAAACAAGAACAACGTGCTATA
TTATTTGTATCTCATGACCGAACATTTTTAAATGAAACGCCAGATGCTATATTAGAATTGAGTCTTGATGGGGCTAAGAAGTATATCGGT
AAATACGATAAATACAAACAACAAAAAGATATAGAGCATGAAACATTAAAGCTACAGTATGAAAAACAACAAAAAGAACAAGCGGCCATT
GAAGAAACGATTAAAAAATATAAAGCATGGTATCAAAAAGCAGAACAAAGTGCTTCTGTGAGAAGCCCATATCAACAAAAACAATTAAGT
AAGTTAGCGAAACGGTTTAAATCAAAAGAACAACAATTAAATCGTAAACTTGATCAAGAGCATATCCCAAATCCACATAAAAAAGAGAAA
ACTTTCTCAATACAACATCATAATTTTAAATCACATTATTTAGTTCAATTTAATCATGTTTCGTTTGCTTATGATAACCGGAAAATATTC
GATGATGTATCATTCTATATTAAGCGAAATCAAAATGTTATTGTTGAAGGCAGAAATGGTACAGGTAAATCAACTTTAATCAAATTGATA
CTCGGTGAACTCGAGCCAACTAAAGGTGATATAACTGTTCATCCAGAATTAGAAATTGGATATTTCTCTCAAGATTTTGAGAATTTAAAT
ATGCATCATACTGTCTTAGATGAAATATTAGAAATTCCTGAAATGAAAGAAGCAGATGCAAGAACCATATTAGCAAGCTTTTATTTTGAT
AAAGATAGGATAAATGATGTTGTTGAAACACTATCGATGGGTGAAAAATGTAGGTTACAATTTGTAAAATTATATTTTTCAAATCCTCAT
ATTATGATATTAGATGAGCCAACAAACTATTTCGATATTGGCATGCAAGAAAATATCATTCAATTAATACAATCATTTCAAGGTTCGGTC
CTTATTGTATCTCATGATAATTATTTTAAATCACAAATTAAAGATCAGACTTGGACTATAAAAAATCATCAAATGACGCATGAAAATGTT
CAAGTCAAAGATCCTATTAATACAGAATCTATGAAACATCATTTAAAAGAATTAGAACAATATACAGATGAAAGAAATCGTGAAACAGAG
TTCTAG