MuxB

Accession ARO:3004074
Synonym(s)PA2527
DefinitionMuxB is one of the two necessary RND components in the Pseudomonas aeruginosa efflux pump system MuxABC-OpmB.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classtetracycline antibiotic, aminocoumarin antibiotic, macrolide antibiotic, monobactam
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesPseudomonas fluorescensg
Classification18 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Mima T, et al. 2009. Microbiology (Reading, Engl.) 155(Pt 11):3509-17 Gene cloning and characteristics of the RND-type multidrug efflux pump MuxABC-OpmB possessing two RND components in Pseudomonas aeruginosa. (PMID 19713238)

Resistomes

Prevalence of MuxB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.04%
Citrobacter freundii0%0%0%
Citrobacter koseri0%0%0%
Escherichia coli0%0%0%
Klebsiella oxytoca0%0%0%
Pseudomonas aeruginosa0%0%0%
Pseudomonas fluorescens3.7%0%0%
Salmonella enterica0%0%0.03%
Staphylococcus aureus0%0%0%
Stenotrophomonas maltophilia0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1900


>gb|AAG05915.1|-|MuxB [Pseudomonas aeruginosa PAO1]
MNPSRPFILRPVATTLLMVAILLSGLIAYRFLPISALPEVDYPTIQVVTLYPGASPEIMTSSITAPLENQLGQIPGLNEMSSSSSGGASV
ITLQFSLQSNLDVAEQEVQAAINAAQSLLPNDLPNQPVFSKVNPADAPILTLAVMSDGMPLPQIQDLVDTRLAQKISQISGVGLVSISGG
QRPAVRVRANPTALAAAGLSLEDLRSTVTSNNLNGPKGSFDGPTRASTLDANDQLRSADAYRDLIIAYKNGSPLRIRDVASVEDDAENVR
LAAWANNLPAVVLNIQRQPGANVIEVVDRIKALLPQLQSTLPGNLDVQVLTDRTTTIRASVKDVQFELALAVALVVMVTFLFLRNVYATL
IPSFAVPLSLIGTFGVMYLSGFSINNLTLMALTIATGFVVDDAIVMVENIARYLEQGDSPLEAALKGSKQIGFTIISLTFSLIAVLIPLL
FMGDVAGRLFREFAITLAVAILISGFVSLTLTPMLSAKLLRHIDEDQQGRFARAAGRVIDGLIAQYAKALRVVLRHQPLTLLVAIATLAL
TALLYLAMPKGFFPVQDTGVIQGVAEAPQSISFQAMSERQRALAEVVLKDPAVASLSSYIGVDGSNPTLNTGRLLINLKPHSERDVTASE
VIQRLQPELDHLPGIKLYMQPVQDLTIEDRVARTQYQFTLQDADPDVLAEWVPKLVARLQELPQLADVASDWQDKGLQAYLNIDRDTASR
LGVKLSDIDSVLYNAFGQRLISTIFTQATQYRVVLEVAPQFQLGPQALEQLYVPSSDGTQVRLSSLAKVEERHTLLAINHIAQFPSATLS
FNLAKGYSLGEAVEAIRGVEASLELPLSMQGSFRGAALAFEASLSNTLLLILASVVTMYIVLGILYESFIHPVTILSTLPSAGVGALLAL
MLAGQEIGIVAIIGIILLIGIVKKNAIMMIDFALDAERNEGKPPHEAIYQACLLRFRPILMTTMAALLGALPLMLAGGAGAELRQPLGIT
MVGGLLLSQVLTLFTTPVIYLYFDRLARRWAAWRKQRGLDLNTEAGFDGDAGR


>gb|AE004091.2|-|2850883-2854014|MuxB [Pseudomonas aeruginosa PAO1]
ATGAACCCGTCCCGCCCGTTCATCCTGCGGCCGGTCGCGACCACCCTGCTGATGGTGGCGATCCTGCTCTCGGGCCTGATCGCCTACCGC
TTCCTGCCGATCTCGGCGTTGCCGGAAGTGGACTACCCGACCATCCAGGTGGTCACCCTGTACCCCGGCGCCAGCCCGGAGATCATGACC
TCGTCGATCACCGCGCCGCTGGAGAACCAGCTCGGGCAGATTCCGGGGCTCAACGAGATGTCTTCCAGCAGTTCCGGCGGCGCCTCGGTG
ATCACCCTGCAATTCAGCCTGCAGAGCAACCTCGATGTCGCCGAGCAGGAAGTCCAGGCGGCGATCAACGCCGCGCAGAGCCTGCTGCCC
AACGACCTGCCGAACCAGCCGGTGTTCAGCAAGGTGAATCCGGCGGACGCACCGATCCTGACCCTGGCGGTGATGTCCGACGGCATGCCG
CTGCCGCAGATCCAGGACCTGGTGGATACCCGCCTGGCACAGAAGATCTCGCAGATCTCCGGGGTCGGCCTGGTCAGCATCAGCGGCGGC
CAGCGCCCGGCGGTGCGGGTGCGCGCCAACCCGACGGCGCTGGCGGCGGCGGGGCTGAGCCTGGAGGACCTGCGCAGCACGGTGACCAGC
AACAACCTCAACGGCCCCAAGGGCAGCTTCGACGGCCCGACCCGTGCCTCGACCCTGGACGCCAACGACCAGTTGCGCTCGGCCGACGCC
TACCGCGACCTGATCATCGCCTACAAGAACGGCTCGCCGCTGCGCATCCGCGACGTCGCCAGCGTCGAGGACGACGCCGAGAACGTGCGC
CTGGCCGCCTGGGCCAACAACCTGCCGGCGGTGGTGCTGAACATCCAGCGCCAGCCGGGGGCCAACGTGATCGAGGTGGTCGACCGGATC
AAGGCGCTGCTGCCGCAGCTGCAATCGACCCTGCCGGGCAATCTCGACGTGCAGGTGCTGACCGACCGCACCACCACCATCCGCGCCTCG
GTCAAGGACGTGCAGTTCGAGCTGGCGCTGGCGGTGGCGCTGGTGGTGATGGTCACCTTCCTGTTCCTGCGCAACGTCTACGCCACCCTG
ATTCCCAGCTTCGCCGTGCCGCTGTCGCTGATCGGTACCTTCGGCGTGATGTACCTGTCCGGCTTCTCGATCAACAACCTGACCCTGATG
GCGCTGACCATCGCCACCGGCTTCGTGGTCGACGACGCGATCGTCATGGTGGAGAACATCGCCCGCTACCTGGAGCAGGGCGACTCGCCG
CTGGAAGCGGCGCTCAAGGGCTCGAAGCAGATCGGCTTCACCATCATCTCGCTGACTTTCTCGCTGATCGCCGTGCTGATCCCGCTGCTG
TTCATGGGCGACGTCGCCGGGCGGCTGTTCCGCGAGTTCGCCATCACCCTGGCGGTGGCGATCCTGATTTCCGGCTTCGTCTCCCTGACC
CTTACGCCGATGCTCAGCGCCAAGCTGCTGCGCCACATCGACGAGGACCAGCAGGGCCGCTTCGCGCGCGCCGCGGGGCGGGTCATCGAT
GGCCTGATCGCACAGTACGCCAAGGCCCTGCGGGTGGTCCTGCGGCACCAGCCGCTGACCCTGCTGGTGGCCATCGCCACCCTGGCGCTG
ACCGCGCTACTCTACCTGGCCATGCCCAAGGGCTTCTTCCCGGTGCAGGACACCGGGGTGATCCAGGGCGTCGCCGAAGCGCCGCAGTCG
ATCTCCTTCCAGGCCATGTCCGAGCGCCAGCGCGCCCTTGCCGAGGTGGTGCTGAAGGACCCGGCGGTGGCCAGCCTGTCCTCCTACATC
GGCGTCGACGGCAGCAACCCGACCCTCAACACCGGCCGCCTGCTGATCAACCTCAAGCCGCACAGCGAGCGCGACGTCACCGCCAGCGAA
GTGATCCAGCGCCTGCAGCCCGAACTCGACCACCTGCCCGGGATCAAGCTGTACATGCAGCCGGTGCAGGACCTGACCATCGAGGACCGG
GTCGCCCGCACCCAGTACCAGTTCACCTTGCAGGACGCCGACCCGGACGTGCTCGCCGAGTGGGTGCCGAAGCTGGTGGCGCGGCTGCAG
GAGTTGCCGCAGCTCGCCGACGTCGCCAGCGACTGGCAGGACAAGGGCTTGCAGGCCTACCTGAACATCGACCGCGACACCGCCTCGCGC
CTCGGCGTGAAGCTCTCCGACATCGACAGCGTGCTCTACAACGCCTTCGGCCAGCGGCTGATCTCGACCATCTTCACCCAGGCCACCCAG
TACCGCGTGGTGCTGGAGGTGGCGCCGCAGTTCCAGCTCGGCCCGCAGGCCCTGGAGCAGCTCTACGTGCCGTCCAGCGACGGCACCCAG
GTGCGCCTGTCGAGCCTGGCGAAGGTGGAGGAGCGGCATACCCTGCTGGCGATCAACCATATCGCCCAGTTCCCCTCGGCGACCCTGTCG
TTCAACCTGGCCAAGGGTTACTCCCTGGGCGAGGCGGTCGAGGCGATCCGTGGCGTCGAGGCCAGCCTGGAGCTGCCGCTGAGCATGCAG
GGCAGCTTCCGCGGCGCGGCGCTGGCCTTCGAGGCCTCGCTGTCGAACACGCTGCTGCTGATCCTCGCCTCGGTGGTGACCATGTACATC
GTCCTGGGCATCCTCTACGAGAGCTTCATCCATCCGGTGACCATCCTCTCGACCCTGCCCTCGGCCGGGGTCGGCGCGCTGCTGGCGCTG
ATGCTGGCGGGGCAGGAGATCGGCATCGTGGCGATCATCGGCATCATCCTGCTGATCGGCATCGTCAAGAAGAACGCGATCATGATGATC
GATTTCGCCCTCGACGCCGAGCGCAACGAAGGCAAGCCGCCCCATGAGGCGATCTACCAGGCCTGCCTGCTGCGCTTCCGGCCGATCCTG
ATGACCACCATGGCCGCGCTGCTCGGCGCGCTGCCGCTGATGCTCGCCGGCGGCGCCGGCGCCGAGCTGCGCCAGCCGCTGGGCATCACC
ATGGTCGGTGGCCTGCTGCTGAGCCAGGTCCTGACCCTGTTCACCACCCCGGTGATCTATCTCTACTTCGACCGCCTGGCCCGTCGCTGG
GCGGCCTGGCGCAAGCAGCGCGGGCTGGACCTGAACACCGAGGCCGGGTTCGACGGGGACGCCGGGCGATGA