LAP-1

Accession ARO:3004825
CARD Short NameLAP-1
DefinitionLAP-1 is an Ambler Class A beta-lactamase gene.
AMR Gene FamilyLAP beta-lactamase
Drug Classcephalosporin, penem, penam
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesEnterobacter hormaecheiwgs, Escherichia coliwgs, Klebsiella pneumoniaewgs
Resistomes with Sequence VariantsEnterobacter cloacaep, Enterobacter hormaecheiwgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Shigella flexneriwgs
Classification15 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic cefepime [Antibiotic]
+ confers_resistance_to_antibiotic cefuroxime [Antibiotic]
+ confers_resistance_to_antibiotic amoxicillin [Antibiotic]
+ confers_resistance_to_antibiotic piperacillin [Antibiotic]
+ confers_resistance_to_antibiotic benzylpenicillin [Antibiotic]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
+ confers_resistance_to_antibiotic ticarcillin [Antibiotic]
+ LAP beta-lactamase [AMR Gene Family]
Publications

Poirel L, et al. 2006. Antimicrob. Agents Chemother. 50(12):3992-7 Prevalence and genetic analysis of plasmid-mediated quinolone resistance determinants QnrA and QnrS in Enterobacteriaceae isolates from a French university hospital. (PMID 16982792)

Poirel L, et al. 2007. Antimicrob. Agents Chemother. 51(2):631-7 Novel Ambler class A beta-lactamase LAP-1 and its association with the plasmid-mediated quinolone resistance determinant QnrS1. (PMID 17116662)

Resistomes

Prevalence of LAP-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Enterobacter cloacae0%0.62%0%0%
Enterobacter hormaechei0%0%0.18%0%
Escherichia coli0%0%0.02%0%
Klebsiella pneumoniae0%0%0.06%0%
Klebsiella quasipneumoniae0%0%0.66%0%
Shigella flexneri0%0%0.16%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 585


>gb|ABK58097.1|+|LAP-1 [Enterobacter cloacae]
MKKIRLIIISLLAGMCTPALSTPVNVTDTIQSTEDHIKGRVGFTEIDFLSGKVLSSHRREERFPMMSTFKVLLCGAILVRVDKGLEQLER
RITYNKHDLDDYSPLTSQHIADGMTVSELCNAAITTSDNTAANLLLSTIGGPEGLTHFLRSTGDSYTRLDRHEPSLNEAKPGDERDTTTP
AAMAQTLQKLLNGSVLTEKSRKKLISWMQEDKVGGPLFRSVLPAGWMIADKTGAGDHGSRGIVALLGPGGKPSRIVVLYITNTHSSMNEL
NEHIAGIGDSVIKNW


>gb|EF026092.1|+|1-858|LAP-1 [Enterobacter cloacae]
ATGAAAAAGATCCGCCTTATTATAATCTCTTTACTGGCTGGAATGTGTACTCCAGCATTATCTACACCAGTCAATGTTACTGATACAATA
CAAAGCACAGAAGACCATATCAAAGGTCGGGTTGGTTTTACTGAAATAGACTTTTTATCCGGGAAGGTTCTGAGTAGTCATCGCCGTGAA
GAACGTTTTCCTATGATGAGCACATTCAAAGTTTTGTTATGTGGAGCAATATTAGTACGTGTTGATAAAGGGCTTGAACAACTTGAACGC
CGAATTACCTATAATAAGCATGACCTGGACGACTATTCTCCACTAACCAGTCAGCACATTGCAGATGGAATGACGGTTTCTGAGTTATGC
AATGCTGCCATTACCACCAGTGATAACACTGCTGCAAATTTATTGCTATCAACTATTGGCGGGCCGGAGGGATTAACTCATTTTCTGCGT
AGCACTGGTGATAGTTATACAAGGCTTGATCGACACGAACCCAGCCTTAATGAGGCGAAGCCTGGCGATGAGCGTGATACCACCACTCCG
GCAGCGATGGCTCAAACGCTACAAAAATTGTTAAACGGAAGTGTACTTACAGAAAAATCTCGAAAAAAATTAATAAGCTGGATGCAGGAA
GATAAAGTCGGCGGGCCTCTGTTCCGCTCTGTACTGCCAGCTGGCTGGATGATAGCGGATAAAACAGGAGCAGGTGATCACGGATCTCGG
GGCATCGTTGCACTGTTGGGCCCCGGAGGCAAGCCATCTCGTATAGTAGTCCTGTATATTACAAATACTCATTCATCTATGAATGAACTC
AACGAGCATATTGCAGGGATCGGAGATTCAGTAATTAAGAACTGGTAA