MAB

Accession ARO:3007180
CARD Short NameMAB
DefinitionMAB is a broad-spectrum class A beta-lactamase produced by Mycobacterium abscessus that has been shown to hydrolyze a large number of beta-lactam antibiotics.
AMR Gene Familyclass A Mycobacterium abscessus beta-lactamase
Drug Classpenam, penem, cephalosporin
Resistance Mechanismantibiotic inactivation
Classification15 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic cefuroxime [Antibiotic]
+ confers_resistance_to_antibiotic amoxicillin [Antibiotic]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
+ confers_resistance_to_antibiotic ticarcillin [Antibiotic]
+ class A Mycobacterium abscessus beta-lactamase [AMR Gene Family]
Publications

Soroka D, et al. 2014. J Antimicrob Chemother 69(3):691-6 Characterization of broad-spectrum Mycobacterium abscessus class A β-lactamase. (PMID 24132992)

Lefebvre AL, et al. 2017. Antimicrob Agents Chemother 61(4): Inhibition of the β-Lactamase BlaMab by Avibactam Improves the In Vitro and In Vivo Efficacy of Imipenem against Mycobacterium abscessus. (PMID 28096155)

Resistomes

Prevalence of MAB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|ALP44181.1|+|MAB [Mycobacteroides abscessus]
MISRRALLVGGVSAVGVVAAGCSRNGNRRPAPDELASLEKDFGGRIGVYALDTGSGDTVGHRADERFLMCSTVKTFIVSAILRRRLSEPG
LLDQRIQYTQSDVLEWAPITSQHVSTGMTVSELCDATLRYSDNTGANLLITQLGGPKETEKFVRSLGDNVTRMDRTEVQLNIPDGDLDTS
TPQQLVANLRRLVLDEGLDSRGRDLLTDWLKRNTTGDQSIRAAVPAGWTVADKTGGGFKGETNDIAVIWPPGRAPIVMAVLTVPEDPTST
KGKPTIAAATRIVLRAFGA


>gb|KT159981.2|+|249-1118|MAB [Mycobacteroides abscessus]
ATGATCTCTCGTCGCGCACTTCTTGTCGGTGGGGTATCGGCGGTCGGTGTGGTGGCTGCCGGTTGTTCGCGCAACGGCAACCGTCGGCCC
GCGCCGGACGAACTCGCCTCGCTGGAAAAGGATTTCGGCGGCCGCATCGGTGTCTACGCGTTGGACACCGGGTCGGGTGACACGGTCGGC
CACCGCGCCGATGAACGCTTTCTGATGTGCTCGACGGTCAAGACCTTCATCGTCTCGGCCATCCTGCGCCGGAGACTGAGCGAACCGGGC
CTGTTGGACCAGCGAATTCAGTACACGCAATCCGACGTTCTGGAATGGGCGCCGATCACCTCGCAACACGTGTCCACCGGAATGACCGTC
TCGGAACTGTGTGATGCGACGCTCCGCTATAGCGACAACACCGGTGCCAACCTGCTGATCACCCAACTCGGCGGCCCGAAGGAGACAGAG
AAGTTCGTCCGAAGCCTGGGCGACAACGTCACTCGCATGGACCGCACGGAGGTACAGCTGAACATCCCCGACGGCGATCTGGATACCTCG
ACCCCGCAGCAGCTGGTGGCCAATCTGCGCCGACTGGTCCTCGACGAAGGGCTGGATTCACGGGGACGGGATCTGCTGACCGATTGGTTG
AAGCGAAATACCACCGGCGACCAGTCCATTCGGGCAGCAGTTCCCGCCGGGTGGACGGTCGCAGACAAGACCGGCGGCGGCTTCAAGGGT
GAAACCAACGACATCGCGGTGATCTGGCCCCCGGGCCGTGCACCCATCGTGATGGCGGTACTCACCGTCCCGGAGGACCCCACATCCACC
AAAGGTAAGCCGACGATTGCCGCGGCCACCCGAATCGTGCTGCGGGCCTTCGGCGCTTGA