TEM-1

Accession ARO:3000873
Synonym(s)TEM-98 RTEM-1 TEM-1B
DefinitionTEM-1 is a broad-spectrum beta-lactamase found in many Gram-negative bacteria. Confers resistance to penicillins and first generation cephalosphorins.
AMR Gene FamilyTEM beta-lactamase
Drug Classpenam, cephalosporin, penem, monobactam
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniig+wgs, Chlamydia trachomatiswgs, Citrobacter amalonaticuswgs, Citrobacter freundiig+p+wgs, Citrobacter koserig+wgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterococcus faeciumwgs, Escherichia colig+p+wgs, Haemophilus influenzaeg+wgs, Haemophilus parainfluenzaewgs, Klebsiella aerogenesg+p+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiig+wgs, Neisseria gonorrhoeaep+wgs, Proteus mirabilisg+p+wgs, Proteus vulgarisp, Providencia rettgerig+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidawgs, Raoultella planticolap, Salmonella entericag+p+wgs, Serratia marcescensg+p+wgs, Shigella dysenteriaep+wgs, Shigella flexnerip+wgs, Shigella sonneig+p+wgs, Vibrio choleraep+wgs, Vibrio parahaemolyticusp
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Chlamydia trachomatiswgs, Citrobacter amalonaticuswgs, Citrobacter freundiig+p+wgs, Citrobacter koserig+wgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterococcus faeciumwgs, Escherichia colig+p+wgs, Haemophilus influenzaeg+wgs, Haemophilus parainfluenzaewgs, Klebsiella aerogenesg+p+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiig+wgs, Neisseria gonorrhoeaep+wgs, Proteus mirabilisg+p+wgs, Proteus vulgarisp, Providencia rettgerig+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidawgs, Raoultella planticolap, Salmonella entericag+p+wgs, Serratia marcescensg+p+wgs, Shigella dysenteriaep+wgs, Shigella flexnerip+wgs, Shigella sonneig+p+wgs, Vibrio choleraep+wgs, Vibrio parahaemolyticusp
Classification17 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic amoxicillin [Antibiotic]
+ TEM beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
Publications

Datta N and Kontomichalou P. 1965. Nature 208(5007): 239-241. Penicillinase synthesis controlled by infectious R factors in Enterobacteriaceae. (PMID 5326330)

Sutcliffe JG. 1978. Proc Natl Acad Sci U S A 75(8): 3737-3741. Nucleotide sequence of the ampicillin resistance gene of Escherichia coli plasmid pBR322. (PMID 358200)

Salverda ML, et al. 2010. FEMS Microbiol. Rev. 34(6):1015-36 Natural evolution of TEM-1 β-lactamase: experimental reconstruction and clinical relevance. (PMID 20412308)

Resistomes

Prevalence of TEM-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii29.35%0%36.25%
Chlamydia trachomatis0%0%2.56%
Citrobacter amalonaticus0%0%18.75%
Citrobacter freundii7.89%15.09%23.57%
Citrobacter koseri12.5%0%10.34%
Citrobacter youngae0%0%12.5%
Enterobacter asburiae0%0%14.29%
Enterobacter cloacae6.98%21.84%23.83%
Enterobacter hormaechei1.61%23.08%41.44%
Enterobacter kobei0%22.22%27.54%
Enterococcus faecium0%0%0.12%
Escherichia coli3.32%4.03%29.23%
Haemophilus influenzae12.86%0%12.15%
Haemophilus parainfluenzae0%0%5.41%
Klebsiella aerogenes3.45%8%11.74%
Klebsiella oxytoca0%10%5.45%
Klebsiella pneumoniae0.6%7.65%50.47%
Morganella morganii11.76%0%12.5%
Neisseria gonorrhoeae0%10.39%5.69%
Proteus mirabilis11.9%8.33%27.93%
Proteus vulgaris0%25%0%
Providencia rettgeri12.5%0%9.38%
Providencia stuartii0%0%8.33%
Pseudomonas aeruginosa0.77%3.85%0.38%
Pseudomonas putida0%0%1.04%
Raoultella planticola0%5.88%0%
Salmonella enterica6.36%10.43%16.06%
Serratia marcescens3.23%7.95%9.11%
Shigella dysenteriae0%2.94%8.82%
Shigella flexneri0%19.74%17.11%
Shigella sonnei5.26%11.29%33%
Vibrio cholerae0%16.67%0.57%
Vibrio parahaemolyticus0%0.41%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|CAD09800.1|+|TEM-1 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLG
RRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDE
RNRQIAEIGASLIKHW


>gb|AL513383|+|161911-162771|TEM-1 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
ATGAGTATTCAACATTTTCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAA
GTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCC
GAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGTGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGT
CGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTA
TGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTG
CACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATG
CCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAG
GCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCT
CGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAA
CGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA