TEM-1

Accession ARO:3000873
Synonym(s)RTEM-1 TEM-1B
CARD Short NameTEM-1
DefinitionTEM-1 is a broad-spectrum beta-lactamase found in many Gram-negative bacteria. Confers resistance to penicillins and first generation cephalosphorins.
AMR Gene FamilyTEM beta-lactamase
Drug Classpenam, monobactam, penem, cephalosporin
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs, Acinetobacter calcoaceticuswgs, Acinetobacter johnsoniiwgs, Acinetobacter radioresistenswgs, Acinetobacter towneriwgs, Aeromonas caviaeg, Aeromonas hydrophilag, Aeromonas veroniig+p+wgs, Bacillus subtilisg+wgs, Bacteroides fragiliswgs, Chlamydia trachomatiswgs, Citrobacter amalonaticusp+wgs, Citrobacter freundiig+p+wgs, Citrobacter koserig+p+wgs, Citrobacter portucalensisg+p+wgs, Citrobacter werkmaniip+wgs, Citrobacter youngaewgs, Cronobacter malonaticuswgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeig+p+wgs, Enterobacter roggenkampiip+wgs, Enterococcus faeciumwgs, Escherichia albertiig+p+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+p+wgs, Escherichia marmotaewgs, Haemophilus influenzaeg+p+wgs, Haemophilus parainfluenzaeg+wgs, Klebsiella aerogenesg+p+wgs, Klebsiella huaxiensisg, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaeg+p+wgs, Leclercia adecarboxylatawgs, Morganella morganiig+p+wgs, Neisseria gonorrhoeaep+wgs, Neisseria siccawgs, Pasteurella multocidag+wgs, Proteus mirabilisg+p+wgs, Proteus pennerip, Proteus vulgarisp, Providencia rettgerig+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas monteiliiwgs, Pseudomonas putidawgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescensg+p+wgs, Shigella boydiiwgs, Shigella dysenteriaeg+p+wgs, Shigella flexnerig+p+wgs, Shigella sonneip+wgs, Staphylococcus epidermidisg, Streptococcus suiswgs, Vibrio choleraep+wgs, Vibrio parahaemolyticusp
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter calcoaceticuswgs, Acinetobacter johnsoniiwgs, Acinetobacter nosocomialiswgs, Acinetobacter radioresistenswgs, Acinetobacter towneriwgs, Aeromonas caviaeg, Aeromonas hydrophilag, Aeromonas veroniig+p+wgs, Bacillus subtilisg+wgs, Bacteroides fragiliswgs, Chlamydia trachomatiswgs, Citrobacter amalonaticusp+wgs, Citrobacter freundiig+p+wgs, Citrobacter koserig+p+wgs, Citrobacter portucalensisg+p+wgs, Citrobacter werkmaniip+wgs, Citrobacter youngaewgs, Cronobacter malonaticuswgs, Enterobacter asburiaeg+p+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeig+p+wgs, Enterobacter roggenkampiip+wgs, Enterococcus faeciumwgs, Escherichia albertiig+p+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+p+wgs, Escherichia marmotaewgs, Haemophilus influenzaeg+p+wgs, Haemophilus parainfluenzaeg+wgs, Klebsiella aerogenesg+p+wgs, Klebsiella huaxiensisg, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaeg+p+wgs, Leclercia adecarboxylatawgs, Morganella morganiig+p+wgs, Neisseria gonorrhoeaep+wgs, Neisseria siccawgs, Pasteurella multocidag+wgs, Proteus mirabilisg+p+wgs, Proteus pennerip, Proteus vulgarisp, Providencia rettgerig+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas monteiliiwgs, Pseudomonas putidawgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescensg+p+wgs, Shigella boydiiwgs, Shigella dysenteriaeg+p+wgs, Shigella flexnerig+p+wgs, Shigella sonneip+wgs, Staphylococcus epidermidisg+wgs, Streptococcus suiswgs, Vibrio choleraep+wgs, Vibrio parahaemolyticusp
Classification26 ontology terms | Show
Parent Term(s)7 ontology terms | Show
+ confers_resistance_to_antibiotic cefazolin [Antibiotic]
+ confers_resistance_to_antibiotic amoxicillin [Antibiotic]
+ TEM beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
+ confers_resistance_to_antibiotic amoxicillin-clavulanic acid [Antibiotic+Adjuvant]
+ confers_resistance_to_antibiotic piperacillin-tazobactam [Antibiotic+Adjuvant]
Sub-Term(s)
5 ontology terms | Show
+ tazobactam [Adjuvant] is_small_molecule_inhibitor
+ clavulanic acid [Adjuvant] is_small_molecule_inhibitor
+ SYN-1012 [Adjuvant] is_small_molecule_inhibitor
+ ANT3310 [Adjuvant] is_small_molecule_inhibitor
+ avibactam [Adjuvant] is_small_molecule_inhibitor
Publications

Datta N and Kontomichalou P. 1965. Nature 208(5007): 239-241. Penicillinase synthesis controlled by infectious R factors in Enterobacteriaceae. (PMID 5326330)

Sutcliffe JG. 1978. Proc Natl Acad Sci U S A 75(8): 3737-3741. Nucleotide sequence of the ampicillin resistance gene of Escherichia coli plasmid pBR322. (PMID 358200)

Salverda ML, et al. 2010. FEMS Microbiol. Rev. 34(6):1015-36 Natural evolution of TEM-1 β-lactamase: experimental reconstruction and clinical relevance. (PMID 20412308)

Tsang KK, et al. 2021. Microb Genom 7(1): Identifying novel β-lactamase substrate activity through in silico prediction of antimicrobial resistance. (PMID 33416461)

Resistomes

Prevalence of TEM-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii33.33%0.06%27.47%0%
Acinetobacter calcoaceticus0%0%4.35%0%
Acinetobacter johnsonii0%0%4%0%
Acinetobacter nosocomialis0%0%0.65%0%
Acinetobacter radioresistens0%0%4.88%0%
Acinetobacter towneri0%0%5.26%0%
Aeromonas caviae6.45%0%0%0%
Aeromonas hydrophila6%0%0%0%
Aeromonas veronii3.23%2.33%1.28%0%
Bacillus subtilis0.9%0%0.65%0%
Bacteroides fragilis0%0%0.36%0%
Chlamydia trachomatis0%0%2.63%0%
Citrobacter amalonaticus0%9.09%8.33%0%
Citrobacter freundii2.68%12.18%21.9%0%
Citrobacter koseri6.67%18.75%7.29%0%
Citrobacter portucalensis8%22.73%41.38%0%
Citrobacter werkmanii0%10%35.9%0%
Citrobacter youngae0%0%25%0%
Cronobacter malonaticus0%0%1.82%0%
Enterobacter asburiae3.85%7.27%11.11%0%
Enterobacter chengduensis0%0%28.57%0%
Enterobacter cloacae3.85%9.38%22.66%0%
Enterobacter hormaechei1.28%12.84%25.39%0%
Enterobacter kobei5.56%7.41%14.43%0%
Enterobacter roggenkampii0%2.73%6.48%0%
Enterococcus faecium0%0%0.04%0%
Escherichia albertii9.09%5.13%4.3%0%
Escherichia coli4.14%5.58%22.09%0%
Escherichia fergusonii5.26%6.02%21.13%0%
Escherichia marmotae0%0%6.52%0%
Haemophilus influenzae10.53%100%12.64%0%
Haemophilus parainfluenzae25%0%7.69%0%
Klebsiella aerogenes4.65%10.26%11.11%0%
Klebsiella huaxiensis100%0%0%0%
Klebsiella michiganensis9.62%11.85%11.04%0%
Klebsiella oxytoca0%7.38%8.33%0%
Klebsiella pneumoniae2.12%10.94%34.37%0%
Klebsiella quasipneumoniae0.96%4.85%29.11%0%
Leclercia adecarboxylata0%0%15%0%
Morganella morganii12%2.7%7.59%0%
Neisseria gonorrhoeae0%6.29%5.93%0%
Neisseria sicca0%0%7.69%0%
Pasteurella multocida1.67%0%2.07%0%
Proteus mirabilis21.98%11.94%13.03%0%
Proteus penneri0%100%0%0%
Proteus vulgaris0%12.5%0%0%
Providencia rettgeri6.25%0%2.94%0%
Providencia stuartii0%0%9.09%0%
Pseudomonas aeruginosa0.75%0.64%0.37%0%
Pseudomonas monteilii0%0%2.5%0%
Pseudomonas putida0%0%1.37%0%
Raoultella planticola0%14.29%13.89%0%
Salmonella enterica7.36%9.91%12.3%0%
Serratia marcescens2.48%10.6%6.76%0%
Shigella boydii0%0%28.57%0%
Shigella dysenteriae16.67%5%14.81%0%
Shigella flexneri4.84%17.14%15.47%0%
Shigella sonnei0%10%32.89%0%
Staphylococcus epidermidis0.91%0%0.09%0%
Streptococcus suis0%0%0.06%0%
Vibrio cholerae0%17.65%0.55%0%
Vibrio parahaemolyticus0%0.34%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|CAD09800.1|+|TEM-1 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLG
RRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDE
RNRQIAEIGASLIKHW


>gb|AL513383.1|+|161911-162771|TEM-1 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
ATGAGTATTCAACATTTTCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAA
GTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCC
GAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGTGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGT
CGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTA
TGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTG
CACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATG
CCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAG
GCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCT
CGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAA
CGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA