ACC-1

Download Sequences

Accession	ARO:3001815
CARD Short Name	ACC-1
Definition	ACC-1 is a beta-lactamase found in Klebsiella pneumoniae.
AMR Gene Family	ACC beta-lactamase
Drug Class	penicillin beta-lactam, cephalosporin, monobactam
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Citrobacter freundii^wgs, Enterobacter hormaechei^p+wgs, Escherichia coli^wgs, Klebsiella pneumoniae^wgs, Salmonella enterica^wgs, Serratia marcescens^wgs
Resistomes with Sequence Variants	Citrobacter freundii^wgs, Enterobacter hormaechei^p+wgs, Escherichia coli^wgs, Klebsiella pneumoniae^wgs, Salmonella enterica^wgs, Serratia marcescens^wgs
Classification	18 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + beta-lactam antibiotic + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + penicillin beta-lactam [Drug Class] + beta-lactamase + cephalosporin [Drug Class] + penicillin with extended spectrum + fourth-generation cephalosporin + third-generation cephalosporin + second-generation cephalosporin + class C beta-lactamase + monobactam [Drug Class]
Parent Term(s)	10 ontology terms \| Show + confers_resistance_to_antibiotic cefepime [Antibiotic] + confers_resistance_to_antibiotic ceftazidime [Antibiotic] + confers_resistance_to_antibiotic piperacillin [Antibiotic] + ACC beta-lactamase [AMR Gene Family] + confers_resistance_to_antibiotic aztreonam [Antibiotic] + confers_resistance_to_antibiotic cefotaxime [Antibiotic] + confers_resistance_to_antibiotic cefotetan [Antibiotic] + confers_resistance_to_antibiotic flomoxef [Antibiotic] + confers_resistance_to_antibiotic moxalactam [Antibiotic] + confers_resistance_to_antibiotic cefpirome [Antibiotic]
Sub-Term(s)	4 ontology terms \| Show + ACC-1a + ACC-1b + ACC-1c + ACC-1d
Publications	Bauernfeind A, et al. 1999. Antimicrob Agents Chemother 43(8): 1924-1931. A novel type of AmpC beta-lactamase, ACC-1, produced by a Klebsiella pneumoniae strain causing nosocomial pneumonia. (PMID 10428914)

Resistomes

Prevalence of ACC-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter freundii	0%	0%	1.16%	0%	0%
Citrobacter freundii	0%	0%	1.16%	0%	0%
Enterobacter hormaechei	0%	0.9%	0.13%	0%	0%
Enterobacter hormaechei	0%	0.9%	0.13%	0%	0%
Escherichia coli	0%	0%	0.02%	0%	0%
Escherichia coli	0%	0%	0.02%	0%	0%
Klebsiella pneumoniae	0%	0%	0.03%	0%	0%
Klebsiella pneumoniae	0%	0%	0.03%	0%	0%
Salmonella enterica	0%	0%	0.01%	0%	0%
Salmonella enterica	0%	0%	0.01%	0%	0%
Serratia marcescens	0%	0%	0.13%	0%	0%
Serratia marcescens	0%	0%	0.13%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700

Protein
DNA

>gb|CAB46491.1|+|ACC-1 [Klebsiella pneumoniae]
MQNTLKLLSVITCLAATVQGALAANIDESKIKDTVDDLIQPLMQKNNIPGMSVAVTVNGKNYIYNYGLAAKQPQQPVTENTLFEVGSLSK
TFAATLASYAQVSGKLSLDQSVSHYVPELRGSSFDHVSVLNVGTHTSGLQLFMPEDIKNTTQLMAYLKAWKPADAAGTHRVYSNIGTGLL
GMIAAKSLGVSYEDAIEKTLLPQLGMHHSYLKVPADQMENYAWGYNKKDEPVHVNMEILGNEAYGIKTTSSDLLRYVQANMGQLKLDANA
KMQQALTATHTGYFKSGEITQDLMWEQLPYPVSLPNLLTGNDMAMTKSVATPIVPPLPPQENVWINKTGSTNGFGAYIAFVPAKKMGIVM
LANKNYSIDQRVTVAYKILSSLEGNK

>gb|AJ133121.1|+|650-1810|ACC-1 [Klebsiella pneumoniae]
ATGCAGAACACATTGAAGCTGTTATCCGTGATTACCTGTCTGGCAGCAACTGTCCAAGGTGCTCTGGCTGCTAATATCGATGAGAGCAAA
ATTAAAGACACCGTTGATGACCTGATCCAGCCGCTGATGCAGAAGAATAATATTCCCGGTATGTCGGTCGCAGTGACCGTCAACGGTAAA
AACTACATTTATAACTATGGGTTAGCGGCAAAACAGCCTCAGCAGCCGGTTACGGAAAATACGTTATTTGAAGTGGGTTCGCTGAGTAAA
ACGTTTGCTGCCACCTTGGCGTCCTATGCGCAGGTGAGCGGTAAGCTGTCTTTGGATCAAAGCGTTAGCCATTACGTTCCAGAGTTGCGT
GGCAGCAGCTTTGACCACGTTAGCGTACTCAATGTGGGCACGCATACCTCAGGCCTACAGCTATTTATGCCGGAAGATATTAAAAATACC
ACACAGCTGATGGCTTATCTAAAAGCATGGAAACCTGCCGATGCGGCTGGAACCCATCGCGTTTATTCCAATATCGGTACTGGTTTGCTA
GGGATGATTGCGGCGAAAAGTCTGGGTGTGAGCTATGAAGATGCGATTGAGAAAACCCTCCTTCCTCAGTTAGGCATGCATCACAGCTAC
TTGAAGGTTCCGGCTGACCAGATGGAAAACTATGCGTGGGGCTACAACAAGAAAGATGAGCCAGTGCACGTGAATATGGAGATTTTGGGT
AACGAAGCTTATGGTATCAAAACCACCTCCAGCGACTTGTTACGCTACGTGCAAGCCAATATGGGGCAGTTAAAGCTTGATGCTAATGCC
AAGATGCAACAGGCTCTGACAGCCACCCACACCGGCTATTTCAAATCGGGTGAGATTACTCAGGATCTGATGTGGGAGCAGCTGCCATAT
CCGGTTTCTCTGCCGAATTTGCTCACCGGTAACGATATGGCGATGACGAAAAGCGTGGCTACGCCGATTGTTCCGCCGTTACCGCCACAG
GAAAATGTGTGGATTAATAAGACCGGATCAACTAACGGCTTCGGTGCCTATATTGCGTTTGTTCCTGCTAAGAAGATGGGGATCGTGATG
CTGGCTAACAAAAACTACTCAATCGATCAGCGAGTGACGGTGGCGTATAAAATCCTGAGCTCATTGGAAGGGAATAAGTAG

Curator Acknowledgements

Curator	Description	Most Recent Edit

ACC-1

Prevalence: protein homolog model (view sequences)

Graph