CTX-M-27

Download Sequences

Accession	ARO:3001889
CARD Short Name	CTX-M-27
Definition	CTX-M-27 is a beta-lactamase found in Escherichia coli.
AMR Gene Family	CTX-M beta-lactamase
Drug Class	penicillin beta-lactam, cephalosporin, carbapenem
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Escherichia coli^g+p+wgs, Klebsiella pneumoniae^g+p+wgs+gi, Klebsiella quasipneumoniae^p+wgs, Salmonella enterica^p+wgs, Shigella boydii^wgs, Shigella flexneri^wgs, Shigella sonnei^p+wgs
Resistomes with Sequence Variants	Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Escherichia coli^g+p+wgs, Klebsiella pneumoniae^g+p+wgs+gi, Klebsiella quasipneumoniae^p+wgs, Salmonella enterica^p+wgs, Shigella boydii^wgs, Shigella flexneri^wgs, Shigella sonnei^p+wgs
Classification	17 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + beta-lactam antibiotic + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + penicillin beta-lactam [Drug Class] + beta-lactamase + cephalosporin [Drug Class] + penicillin with extended spectrum + third-generation cephalosporin + first-generation cephalosporin + class A beta-lactamase + carbapenem [Drug Class]
Parent Term(s)	7 ontology terms \| Show + confers_resistance_to_antibiotic cefazolin [Antibiotic] + confers_resistance_to_antibiotic ceftazidime [Antibiotic] + confers_resistance_to_antibiotic ertapenem [Antibiotic] + CTX-M beta-lactamase [AMR Gene Family] + confers_resistance_to_antibiotic ampicillin [Antibiotic] + confers_resistance_to_antibiotic cefixime [Antibiotic] + confers_resistance_to_antibiotic cefalotin [Antibiotic]
Sub-Term(s)	2 ontology terms \| Show + avibactam [Adjuvant] is_small_molecule_inhibitor + ARX1796 [Adjuvant] is_small_molecule_inhibitor
Publications	Bonnet R, et al. 2003. J Antimicrob Chemother 52(1): 29-35. Effect of D240G substitution in a novel ESBL CTX-M-27. (PMID 12775683) Tsang KK, et al. 2021. Microb Genom 7(1): Identifying novel β-lactamase substrate activity through in silico prediction of antimicrobial resistance. (PMID 33416461)

Resistomes

Prevalence of CTX-M-27 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Enterobacter cloacae	0%	0%	0.32%	0%	0%
Enterobacter cloacae	0%	0%	0.32%	0%	0%
Enterobacter hormaechei	0%	0%	0.04%	0%	0%
Enterobacter hormaechei	0%	0%	0.04%	0%	0%
Escherichia coli	0.12%	0.59%	2.11%	0%	0%
Escherichia coli	0.12%	0.59%	2.11%	0%	0%
Klebsiella pneumoniae	0.24%	0.12%	0.74%	0.95%	0%
Klebsiella pneumoniae	0.24%	0.12%	0.73%	0.95%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.26%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.26%	0%	0%
Salmonella enterica	0%	0.16%	0.01%	0%	0%
Salmonella enterica	0%	0.16%	0.01%	0%	0%
Shigella boydii	0%	0%	2.22%	0%	0%
Shigella boydii	0%	0%	2.22%	0%	0%
Shigella flexneri	0%	0%	0.62%	0%	0%
Shigella flexneri	0%	0%	0.62%	0%	0%
Shigella sonnei	0%	0.97%	0.29%	0%	0%
Shigella sonnei	0%	0.97%	0.29%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|AAO61597.1|+|CTX-M-27 [Escherichia coli]
MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQ
KQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP
RDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGGYGTTNDIAVIWPQGRAPLVLVTYFTQPQ
QNAESRRDVLASAARIIAEGL

>gb|AY156923.1|+|1-876|CTX-M-27 [Escherichia coli]
ATGGTGACAAAGAGAGTGCAACGGATGATGTTCGCGGCGGCGGCGTGCATTCCGCTGCTGCTGGGCAGCGCGCCGCTTTATGCGCAGACG
AGTGCGGTGCAGCAAAAGCTGGCGGCGCTGGAGAAAAGCAGCGGAGGGCGGCTGGGCGTCGCGCTCATCGATACCGCAGATAATACGCAG
GTGCTTTATCGCGGTGATGAACGCTTTCCAATGTGCAGTACCAGTAAAGTTATGGCGGCCGCGGCGGTGCTTAAGCAGAGTGAAACGCAA
AAGCAGCTGCTTAATCAGCCTGTCGAGATCAAGCCTGCCGATCTGGTTAACTACAATCCGATTGCCGAAAAACACGTCAACGGCACAATG
ACGCTGGCAGAACTGAGCGCGGCCGCGTTGCAGTACAGCGACAATACCGCCATGAACAAATTGATTGCCCAGCTCGGTGGCCCGGGAGGC
GTGACGGCTTTTGCCCGCGCGATCGGCGATGAGACGTTTCGTCTGGATCGCACTGAACCTACGCTGAATACCGCCATTCCCGGCGACCCG
AGAGACACCACCACGCCGCGGGCGATGGCGCAGACGTTGCGTCAGCTTACGCTGGGTCATGCGCTGGGCGAAACCCAGCGGGCGCAGTTG
GTGACGTGGCTCAAAGGCAATACGACCGGCGCAGCCAGCATTCGGGCCGGCTTACCGACGTCGTGGACTGTGGGTGATAAGACCGGCAGC
GGCGGCTACGGCACCACCAATGATATTGCGGTGATCTGGCCGCAGGGTCGTGCGCCGCTGGTTCTGGTGACCTATTTTACCCAGCCGCAA
CAGAACGCAGAGAGCCGCCGCGATGTGCTGGCTTCAGCGGCGAGAATCATCGCCGAAGGGCTGTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

CTX-M-27

Prevalence: protein homolog model (view sequences)

Graph