PDC-5

Accession ARO:3002502
CARD Short NamePDC-5
DefinitionPDC-5 is a extended-spectrum beta-lactamase found in Pseudomonas aeruginosa.
AMR Gene FamilyPDC beta-lactamase
Drug Classpenam, cephalosporin, carbapenem, cephamycin, monobactam
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesPseudomonas aeruginosag+wgs, Pseudomonas fluorescensg
Resistomes with Sequence VariantsPseudomonas aeruginosag+wgs, Pseudomonas fluorescensg
Classification24 ontology terms | Show
Parent Term(s)9 ontology terms | Show
+ confers_resistance_to_antibiotic cefoxitin [Antibiotic]
+ confers_resistance_to_antibiotic cefazolin [Antibiotic]
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ PDC beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ confers_resistance_to_antibiotic cefixime [Antibiotic]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
+ confers_resistance_to_antibiotic amoxicillin-clavulanic acid [Antibiotic+Adjuvant]
Publications

Rodriguez-Martinez JM, et al. 2009. Antimicrob Agents Chemother 53(5): 1766-1771. Extended-spectrum cephalosporinases in Pseudomonas aeruginosa. (PMID 19258272)

Tsang KK, et al. 2021. Microb Genom 7(1): Identifying novel β-lactamase substrate activity through in silico prediction of antimicrobial resistance. (PMID 33416461)

Resistomes

Prevalence of PDC-5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Pseudomonas aeruginosa15.2%0%11.11%0%
Pseudomonas fluorescens2.86%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 750


>gb|ACQ82810.1|+|PDC-5 [Pseudomonas aeruginosa]
MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRQVTPETLFEIGS
VSKTFTATLAGYALAQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNP
SIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPER
LDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRD
LGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR


>gb|FJ666068.1|+|1-1194|PDC-5 [Pseudomonas aeruginosa]
ATGCGCGATACCAGATTCCCCTGCCTGTGCGGCATCGCCGCTTCCACACTGCTGTTCGCCACCACCCCGGCCATTGCCGGCGAGGCCCCG
GCGGATCGCCTGAAGGCACTGGTCGACGCCGCCGTACAACCGGTGATGAAGGCCAATGACATTCCGGGCCTGGCCGTAGCCATCAGCCTG
AAAGGAGAACCGCATTACTTCAGCTATGGGCTGGCCTCGAAAGAGGACGGCCGCCAGGTGACGCCGGAGACCCTGTTCGAGATCGGCTCG
GTGAGCAAGACCTTCACCGCCACCCTCGCCGGCTATGCCCTGGCCCAGGACAAGATGCGCCTCGACGACCGCGCCAGCCAGCACTGGCCG
GCACTGCAGGGCAGCCGCTTCGACGGCATCAGCCTGCTCGACCTCGCGACCTATACCGCCGGCGGCTTGCCGCTGCAGTTCCCCGACTCG
GTGCAGAAGGACCAGGCACAGATCCGCGACTACTACCGCCAGTGGCAGCCGACCTACGCGCCGGGCAGCCAGCGCCTCTATTCCAACCCG
AGCATCGGCCTGTTCGGCTATCTCGCCGCGCGCAGCCTGGGCCAGCCGTTCGAACGGCTCATGGAGCAGCAAGTGTTCCCGGCACTGGGC
CTCGAACAGACCCACCTCGACGTGCCCGAGGCGGCGCTGGCGCAGTACGCCCAGGGCTATGGCAAGGACGACCGCCCGCTACGGGTCGGT
CCCGGCCCGCTGGATGCCGAAGGCTACGGGGTGAAGACCAGCGCGGCCGACCTGCTGCGCTTCGTCGATGCCAACCTGCATCCGGAGCGC
CTGGACAGGCCCTGGGCGCAGGCGCTCGATGCCACCCATCGCGGTTACTACAAGGTCGGCGACATGACCCAGGGCCTGGGCTGGGAAGCC
TACGACTGGCCGATCTCCCTGAAGCGCCTGCAGGCCGGCAACTCGACGCCGATGGCGCTGCAACCGCACAGGATCGCCAGGCTGCCCGCG
CCACAGGCGCTGGAGGGCCAGCGCCTGCTGAACAAGACCGGTTCCACCAACGGCTTCGGCGCCTACGTGGCGTTCGTCCCGGGCCGCGAC
CTGGGCCTGGTGATCCTGGCCAACCGCAACTATCCCAATGCCGAGCGGGTGAAGATCGCCTACGCCATCCTCAGCGGCCTGGAGCAGCAG
GGCAAGGTGCCGCTGAAGCGCTGA