mexQ

Accession ARO:3003699
DefinitionMexQ is the inner membrane transporter of the multidrug efflux pump MexPQ-OpmE.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classtetracycline antibiotic, monobactam, phenicol antibiotic, macrolide antibiotic, diaminopyrimidine antibiotic, fluoroquinolone antibiotic, acridine dye, carbapenem, antibacterial free fatty acids, aminoglycoside antibiotic, aminocoumarin antibiotic, glycylcycline, triclosan, penam
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification32 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Mima T, et al. 2005. Microbiol. Immunol. 49(11):999-1002 Gene cloning and properties of the RND-type multidrug efflux pumps MexPQ-OpmE and MexMN-OprM from Pseudomonas aeruginosa. (PMID 16301811)

Resistomes

Prevalence of mexQ among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterobacter cloacae0%0%0%
Klebsiella pneumoniae0%0%0%
Pseudomonas aeruginosa0%0%0%
Pseudomonas fluorescens3.7%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1900


>gb|BAE06008.1|+|mexQ [Pseudomonas aeruginosa]
MTFPRFFIDRPIFAIVLSVLMMIGGIVSFFQLPLSEYPAVTPPTVQVTTAYPGANPDVIAQTVATPLEQAITGVEGMLYMSSQSATDGRM
ILTITFDQHIDPDMAQIQVQNRVSRVLSRLPDEVQRQGVVTQKTSPDILMVVHLLSPEQRYDPLYISNYAYLQVRDELLRLPGISDVVVW
GAGEYSMRLWLDPDLIAARGLTAGEVIAAVREQNVQVAAGAVGQAPDSTAAFQVTVNTLGRLSDEEQFGDIIVRTGADGQVTRLRDVARI
EMGGDAYALRSLLDGEPAVALQIIQSPGANALDTAEAVRATVARLEGNFPAGLSARIAYDPTVFVRASLQTVATTLLEAILLVVVVVVLF
LRSWRASLIPLMAVPVSLVGTFAVMHLMGFSLNTLSLFGLVLSIGIVVDDAIVVVENVERHIENGEPPLQAARRAMDEVTGPIMAITSVL
AAVFIPTAFLSGLQGEFYRQFALTIAISTILSALNSLTLSPALAGLLLRPRPAGGAVAGRFQRLLQVLGRPLRNAPEAYGNAVRKVVRVS
GLALVVYGGLLGLTWVGFQAVPPGFVPMQDKYYLIGIAQLPNGASLERTDAVVRQMSRIGLDEPGVESVVAFPGLSVNGFVNVPNAAVMF
FMLDPFESRTSADLGALAIAGRLQARFASIPDGFLGVFPPPPVPGLGTIGGFKMQVEDRGGAGLEALARQTQVLMMKATESGQLGGLMTS
FDINAPQLEVVVDRTKVKSQGVRLADVFEALQVYLGSLYINDFNRFGRTYKVTAQADAPHRMQAEAIGRLQVRNAAGAMLPLSSFVTVTP
SSGPDRVIHYNGYPSADISGGALPGVSSGQAVALMERLAGEVLPEGMTFEWTDLTYQQKLAGNSALFIFPLCVLLAYLILAAQYNSWLLP
LAVLLIVPMCLLSAIAGVWLVGGDNNVFVQIGLVVLVGLAAKNAILIVEFARTLEAEGARALEAVVEACRLRLRPILMTSLAFIAGVVPL
VMASGAGAEMRQAMGVAVFAGMLGVTLFGLFLTPVFYVLVRALAARLERRAGGSLAHLEGGRP


>gb|AB219524.1|+|1177-4338|mexQ [Pseudomonas aeruginosa]
ATGACATTCCCACGCTTCTTCATCGATAGGCCGATCTTCGCCATCGTTCTTTCGGTGCTGATGATGATCGGAGGCATCGTTTCGTTCTTC
CAGTTGCCGCTGAGCGAATACCCGGCGGTGACGCCGCCGACCGTGCAGGTGACTACCGCCTATCCCGGCGCCAACCCCGACGTGATCGCG
CAGACGGTGGCGACACCGCTGGAGCAGGCGATCACCGGGGTCGAGGGGATGCTGTACATGTCCTCGCAGTCGGCCACCGACGGGCGAATG
ATCCTGACCATCACCTTCGACCAGCACATCGATCCCGACATGGCCCAGATCCAGGTGCAGAACCGGGTCTCGCGGGTGCTCTCGCGCCTG
CCCGACGAGGTGCAGCGGCAGGGCGTGGTCACCCAGAAGACCTCGCCGGACATCCTCATGGTGGTGCACCTGCTGTCGCCGGAGCAACGC
TACGACCCGCTGTACATCTCGAACTACGCCTACCTCCAGGTGCGCGACGAACTGCTGCGCCTGCCGGGGATCAGCGATGTGGTGGTGTGG
GGCGCCGGCGAGTACAGCATGCGCCTGTGGCTCGACCCCGACCTGATCGCCGCGCGCGGGCTGACGGCGGGCGAAGTGATCGCCGCGGTA
CGCGAACAGAACGTCCAGGTGGCGGCCGGCGCCGTCGGCCAGGCGCCGGACTCCACCGCGGCCTTCCAGGTCACGGTGAATACCCTCGGG
CGGCTGAGCGACGAAGAGCAGTTCGGCGACATCATCGTCCGCACCGGCGCCGACGGCCAGGTGACGCGCCTGCGCGACGTCGCGCGGATC
GAGATGGGCGGCGATGCCTATGCGCTGCGCAGCCTGCTGGACGGCGAGCCGGCGGTGGCCTTGCAGATCATCCAGAGCCCCGGAGCCAAC
GCGCTGGATACCGCCGAAGCGGTGCGTGCCACCGTGGCGAGGCTCGAAGGCAACTTCCCGGCCGGCCTGAGCGCGCGCATCGCCTACGAC
CCGACGGTGTTCGTCCGCGCTTCGTTGCAGACCGTGGCCACCACCCTGCTGGAGGCGATCCTGCTGGTCGTGGTGGTGGTGGTGCTGTTC
CTGCGTAGCTGGCGTGCTTCGCTGATTCCGCTGATGGCCGTGCCGGTCTCGCTGGTCGGCACCTTCGCCGTCATGCACCTGATGGGTTTC
TCGCTGAATACCCTGTCGTTGTTCGGCCTGGTGTTGTCGATCGGCATCGTCGTCGATGACGCCATCGTGGTGGTGGAAAACGTCGAGCGC
CACATCGAGAACGGCGAGCCGCCGCTCCAGGCCGCGCGGCGTGCGATGGACGAGGTCACCGGGCCGATCATGGCGATCACCTCGGTGCTG
GCGGCGGTGTTCATCCCCACGGCCTTTCTCAGTGGCCTGCAGGGCGAGTTCTATCGTCAGTTCGCCCTGACCATCGCCATCTCCACCATC
CTGTCGGCGCTCAACTCGCTGACCCTCAGCCCGGCCCTGGCGGGCCTGCTGTTGCGTCCGCGGCCGGCCGGAGGTGCGGTGGCGGGGCGC
TTCCAGCGACTGCTCCAGGTCCTCGGCCGACCGTTGCGAAATGCCCCCGAGGCCTACGGCAACGCGGTGCGCAAGGTGGTGCGGGTGAGC
GGCCTGGCCCTGGTGGTGTATGGGGGCCTGCTTGGCCTGACCTGGGTCGGTTTCCAGGCGGTGCCGCCGGGCTTCGTGCCGATGCAGGAC
AAGTACTATCTGATCGGCATCGCCCAGTTGCCGAACGGAGCGTCGCTGGAGCGTACCGATGCGGTGGTCAGGCAGATGTCCCGGATCGGC
CTCGACGAGCCGGGGGTGGAGAGCGTCGTGGCCTTCCCGGGCCTGTCGGTGAACGGTTTCGTCAACGTGCCGAACGCCGCGGTCATGTTC
TTCATGCTCGATCCGTTCGAATCGCGCACCTCCGCCGATCTCGGCGCGCTGGCCATCGCCGGGCGCCTGCAAGCCAGGTTCGCCAGCATT
CCCGACGGCTTCCTCGGGGTCTTCCCGCCGCCGCCGGTACCGGGGCTGGGAACCATCGGCGGCTTCAAGATGCAGGTCGAGGATCGCGGC
GGCGCCGGGCTGGAAGCCCTGGCCAGGCAGACCCAGGTGCTGATGATGAAGGCCACTGAGTCCGGCCAGCTCGGGGGCTTGATGACCAGC
TTCGATATCAATGCCCCGCAGCTCGAGGTGGTGGTCGACCGCACCAAGGTGAAGAGCCAGGGCGTTCGCCTGGCCGATGTGTTCGAGGCA
TTGCAGGTCTACCTCGGCTCGCTGTACATCAACGACTTCAACCGCTTCGGTCGCACCTACAAGGTCACTGCCCAGGCCGATGCGCCGCAC
CGCATGCAGGCCGAAGCCATCGGGCGCCTGCAGGTACGCAATGCCGCCGGGGCGATGTTGCCGCTGTCCTCGTTCGTCACCGTGACGCCC
AGCTCCGGTCCCGACCGGGTGATCCACTACAACGGCTATCCGTCGGCGGATATCAGCGGCGGCGCGCTTCCCGGCGTCAGTTCGGGACAG
GCGGTGGCGTTGATGGAGCGCCTGGCCGGCGAAGTGCTGCCCGAGGGCATGACCTTCGAATGGACCGACCTGACCTACCAGCAGAAGCTG
GCCGGCAACAGCGCGCTGTTCATCTTCCCGCTGTGCGTGCTGCTGGCCTACCTGATCCTCGCCGCGCAGTACAACAGCTGGCTGTTGCCG
CTGGCGGTCCTGCTGATCGTGCCGATGTGCCTGCTCAGCGCGATCGCCGGGGTGTGGCTGGTGGGCGGCGACAACAACGTGTTCGTCCAG
ATCGGGCTGGTGGTGCTGGTAGGCCTGGCGGCGAAGAACGCGATCCTGATCGTCGAGTTCGCCCGCACGCTGGAGGCCGAGGGCGCCCGT
GCGCTGGAGGCGGTGGTCGAGGCTTGCCGCCTGCGCCTGCGGCCGATCCTGATGACCTCGCTGGCGTTCATCGCCGGCGTGGTGCCGTTG
GTCATGGCCAGCGGCGCCGGAGCGGAAATGCGCCAGGCGATGGGCGTCGCGGTATTCGCCGGGATGCTCGGGGTGACGCTGTTCGGCCTG
TTCCTCACGCCGGTGTTCTACGTACTGGTACGGGCACTGGCGGCGCGCCTGGAGCGACGCGCCGGCGGCAGCCTGGCGCATCTGGAGGGA
GGCCGTCCATGA