Staphylococcus aureus LmrS

Accession ARO:3004572
Synonym(s)A0A3M7YRP9 A0A3P0BBR7 F6MF49
CARD Short NameSaur_LmrS
DefinitionMFS transporters are secondary active transporters with single-polypeptide chains containing 400-600 amino acids that transport small solutes across the membrane by using electrochemical gradients. LmrS has 14 transmembrane helices and, when expressed in E. coli, is capable of extruding a variety of antibiotics inclinding linezolid, trimethoprim, florfenicol, chlorampheniocol, erythromycin, streptomycin, kanamycin, and fusidic acid.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classaminoglycoside antibiotic, macrolide antibiotic, phenicol antibiotic, oxazolidinone antibiotic, diaminopyrimidine antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesStaphylococcus aureusg+wgs
Resistomes with Sequence VariantsEscherichia coliwgs, Klebsiella pneumoniaewgs, Pseudomonas aeruginosawgs, Salmonella entericawgs, Serratia marcescenswgs, Staphylococcus aureusg+wgs, Staphylococcus epidermidiswgs, Staphylococcus pseudintermediuswgs, Streptococcus pyogeneswgs, Vibrio choleraewgs
Classification11 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic streptomycin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic linezolid [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic florfenicol [Antibiotic]
Publications

Floyd JL, et al. 2010. Antimicrob. Agents Chemother. 54(12):5406-12 LmrS is a multidrug efflux pump of the major facilitator superfamily from Staphylococcus aureus. (PMID 20855745)

Resistomes

Prevalence of Staphylococcus aureus LmrS among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Escherichia coli0%0%0.02%0%
Klebsiella pneumoniae0%0%0.02%0%
Pseudomonas aeruginosa0%0%0.02%0%
Salmonella enterica0%0%0.01%0%
Serratia marcescens0%0%0.15%0%
Staphylococcus aureus99.76%0%61.14%0%
Staphylococcus epidermidis0%0%0.1%0%
Staphylococcus pseudintermedius0%0%0.27%0%
Streptococcus pyogenes0%0%0.05%0%
Vibrio cholerae0%0%0.07%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 800


>gb|AAW38464.1|-|Staphylococcus aureus LmrS [Staphylococcus aureus subsp. aureus COL]
MAKVELTTRRRNFIVAVMLISAFVAILNQTLLNTALPSIMRELNINESTSQWLVTGFMLVNGVMIPLTAYLMDRIKTRPLYLAAMGTFLL
GSIVAALAPNFGVLMLARVIQAMGAGVLMPLMQFTLFTLFSKEHRGFAMGLAGLVIQFAPAIGPTVTGLIIDQASWRVPFIIIVGIAILA
FVFGLVSISSYNEVKYTKLDKRSVMYSTIGFGLMLYAFSSAGDLGFTSPIVIGALILSMVIIYLFIRRQFNITNALLNLRVFKNRTFALC
TISSMIIMMSMVGPALLIPLYVQNSLSLSALLSGLVIMPGAIINGIMSVFTGKFYDKYGPRPLIYTGFTILTITTIMLCFLHTDTSYTYL
IVVYAIRMFSVSLLMMPINTTGINSLRNEEISHGTAIMNFGRVMAGSLGTALMVTLMSFGAKIFLSTSPSHLTATEIKQQSIAIGVDISF
AFVAVLVMAAYVIALFIREPKEIESNRRKF


>gb|CP000046.1|-|2235375-2236817|Staphylococcus aureus LmrS [Staphylococcus aureus subsp. aureus COL]
ATGGCTAAAGTTGAATTAACAACCCGGAGACGAAACTTCATAGTTGCTGTTATGTTGATTAGTGCGTTTGTAGCTATTTTAAATCAAACA
TTATTAAATACAGCGTTACCTAGTATAATGAGAGAATTAAATATCAATGAAAGTACATCGCAATGGCTAGTTACTGGGTTTATGCTTGTT
AATGGCGTCATGATACCTCTGACGGCATATCTAATGGATAGAATTAAAACTAGACCTTTATACTTAGCGGCGATGGGGACATTTTTATTA
GGTTCTATTGTTGCAGCCTTAGCTCCGAATTTTGGAGTTTTAATGTTAGCTCGTGTAATTCAAGCGATGGGTGCAGGCGTACTTATGCCC
TTAATGCAATTTACGTTATTTACATTGTTCAGTAAAGAACATCGAGGTTTTGCAATGGGACTAGCAGGTTTAGTAATTCAATTTGCACCA
GCAATAGGACCTACAGTTACAGGATTAATTATTGATCAAGCGAGTTGGCGAGTTCCATTTATTATAATTGTAGGAATTGCTATACTTGCC
TTTGTTTTCGGTTTGGTTTCAATCTCGAGTTACAATGAAGTGAAATATACGAAATTAGATAAGCGTTCAGTAATGTATTCAACTATTGGG
TTCGGGTTAATGCTATACGCATTTAGTAGTGCAGGAGATTTAGGATTTACAAGTCCAATAGTAATAGGTGCGTTGATATTAAGTATGGTT
ATTATCTATTTATTTATACGTAGACAATTTAATATTACTAATGCACTTTTAAATTTAAGGGTTTTTAAAAATAGAACATTTGCATTATGT
ACGATTAGTTCAATGATTATAATGATGTCAATGGTTGGACCTGCGCTGCTTATACCGCTATATGTTCAAAACAGTTTATCTTTATCTGCC
TTGTTATCAGGACTTGTTATCATGCCTGGTGCAATAATAAATGGTATTATGTCAGTTTTTACAGGTAAATTTTATGATAAGTATGGTCCT
AGACCATTGATTTATACTGGTTTTACAATTTTAACAATTACTACAATTATGTTGTGTTTCTTGCATACAGACACATCTTATACGTATTTA
ATAGTCGTATATGCAATTAGAATGTTTTCAGTTTCTTTACTCATGATGCCGATAAATACTACAGGAATTAATTCTTTGAGAAATGAAGAA
ATCTCACATGGCACGGCTATTATGAACTTTGGTCGTGTAATGGCTGGTTCACTAGGCACAGCTTTAATGGTTACATTAATGAGTTTTGGT
GCAAAAATATTTTTATCTACATCGCCATCGCATTTAACTGCAACTGAAATTAAACAGCAATCCATTGCTATAGGGGTGGATATCTCATTT
GCTTTTGTAGCTGTGCTTGTTATGGCAGCTTATGTGATAGCACTTTTTATAAGAGAACCTAAAGAAATAGAAAGTAATAGAAGGAAATTT
TAA