SCO-1

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004856
Synonym(s)A1E3K9 blaSCO-1
CARD Short NameSCO-1
DefinitionNarrow-spectrum beta-lactamase isolated from several Acinetobacter spp. isolates from Argentina, as well as E. Coli. Hydrolyzes penicillins at a high level and cephalosporins and carbapenems at a very low level.
AMR Gene FamilySCO beta-lactamase
Drug Classpenicillin beta-lactam, cephalosporin
Resistance Mechanismantibiotic inactivation
Classification18 ontology terms | Show
Parent Term(s)9 ontology terms | Show
+ confers_resistance_to_antibiotic cefepime [Antibiotic]
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic cefuroxime [Antibiotic]
+ confers_resistance_to_antibiotic amoxicillin [Antibiotic]
+ confers_resistance_to_antibiotic piperacillin [Antibiotic]
+ confers_resistance_to_antibiotic cefotaxime [Antibiotic]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
+ confers_resistance_to_antibiotic ticarcillin [Antibiotic]
+ SCO beta-lactamase [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniig, Acinetobacter radioresistenswgs, Enterobacter hormaecheiwgs, Escherichia colip+wgs, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs, Proteus mirabiliswgs, Providencia rettgeriwgs, Pseudomonas aeruginosawgs, Salmonella entericawgs, Shigella flexnerip
Resistomes with Sequence VariantsAcinetobacter baumanniig, Acinetobacter radioresistenswgs, Enterobacter cloacaep, Enterobacter hormaecheiwgs, Escherichia colip+wgs, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs, Proteus mirabiliswgs, Providencia rettgeriwgs, Pseudomonas aeruginosawgs, Salmonella entericawgs, Shigella flexnerip
Publications

Papagiannitsis CC, et al. 2011. Antimicrob. Agents Chemother. 55(1):376-81 Sequence of pR3521, an IncB plasmid from Escherichia coli encoding ACC-4, SCO-1, and TEM-1 beta-lactamases. (PMID 20956594)

Poirel L, et al. 2007. Antimicrob. Agents Chemother. 51(6):2179-84 Identification of the novel narrow-spectrum beta-lactamase SCO-1 in Acinetobacter spp. from Argentina. (PMID 17420213)

Papagiannitsis CC, et al. 2007. Antimicrob Agents Chemother 51(6): 2185-2188. SCO-1, a novel plasmid-mediated class A beta-lactamase with carbenicillinase characteristics from Escherichia coli. (PMID 17353248)

Resistomes

Prevalence of SCO-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.18%0%0%0%0%
Acinetobacter radioresistens0%0%3.51%0%0%
Enterobacter cloacae0%0.56%0%0%0%
Enterobacter hormaechei0%0%0.04%0%0%
Escherichia coli0%0.01%0.01%0%0%
Klebsiella michiganensis0%0%0.27%0%0%
Klebsiella oxytoca0%0%0.42%0%0%
Klebsiella pneumoniae0%0.13%0.73%0%0%
Klebsiella quasipneumoniae0%0%0.39%0%0%
Morganella morganii0%0%0.61%0%0%
Proteus mirabilis0%0%0.17%0%0%
Providencia rettgeri0%0%0.64%0%0%
Pseudomonas aeruginosa0%0%0.07%0%0%
Salmonella enterica0%0%0.02%0%0%
Shigella flexneri0%0.4%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Type of Antibiotic Resistance: Acquired


>gb|ABL75133.1|+|SCO-1 [Acinetobacter baumannii]
MTRSALLIPLTTAAIALNAISPVYASDTHSIDDTVKQVETTLGAKVGIAVLDTGSQRAWFHRADDRFPMASTSKALTCAALLDKGQSFMN
KEALIKKADLDEYAPVTSGIVGKKVSAADLCSITMRTSDNTAVNKVLEILGGPQAVTAYLRKTGDNITRLDRNEPDLNEGTPGDVRDTTT
PRAILETLNKLVLGPTLGSDERKQLTTWLESNEVGDPLLRAGVPSDWRVADRTGAGGNGTRGVIAVMWPPKHAPIIAAIYITQTKATMEE
RNAAIASIGKAIAAEVLE


>gb|EF063111.1|+|1122-1988|SCO-1 [Acinetobacter baumannii]
ATGACAAGATCTGCCCTTTTGATTCCACTCACCACGGCGGCTATCGCGCTAAACGCAATATCGCCGGTTTATGCGAGCGACACCCATTCT
ATTGATGATACCGTAAAACAGGTTGAAACCACGCTGGGAGCAAAAGTGGGTATAGCCGTCCTGGACACCGGGTCTCAACGTGCCTGGTTC
CACCGTGCTGATGACCGTTTCCCGATGGCGAGCACATCCAAAGCTCTGACCTGTGCAGCGCTGTTGGATAAAGGTCAGAGCTTTATGAAT
AAAGAGGCCTTGATCAAAAAGGCGGACCTGGATGAATATGCACCAGTGACATCCGGCATAGTCGGCAAAAAAGTAAGTGCGGCTGACCTT
TGCAGCATTACCATGCGTACAAGTGACAATACCGCCGTCAACAAAGTTCTTGAAATCCTGGGAGGACCGCAAGCTGTAACCGCTTATTTG
CGCAAGACAGGTGATAACATTACTCGACTTGACAGAAATGAACCGGACCTCAACGAAGGAACGCCTGGAGACGTGCGCGACACGACAACG
CCTCGCGCTATTCTCGAAACACTTAATAAACTGGTACTGGGCCCCACTCTTGGCTCTGACGAGCGAAAACAACTCACAACCTGGCTTGAA
AGTAATGAGGTTGGTGACCCTTTGCTGCGCGCTGGAGTTCCTTCTGATTGGCGCGTCGCCGATCGAACTGGCGCTGGAGGTAACGGGACG
CGTGGGGTGATTGCCGTCATGTGGCCGCCAAAACACGCGCCAATCATTGCTGCGATTTACATTACACAGACGAAAGCCACTATGGAGGAA
AGGAACGCTGCCATCGCCTCTATTGGCAAAGCGATTGCTGCCGAAGTTCTGGAATAA

Curator Acknowledgements
Curator Description Most Recent Edit