SCO-1

Download Sequences

Ontology	CARD's Antibiotic Resistance Ontology
Accession	ARO:3004856
Synonym(s)	A1E3K9 blaSCO-1
CARD Short Name	SCO-1
Definition	Narrow-spectrum beta-lactamase isolated from several Acinetobacter spp. isolates from Argentina, as well as E. Coli. Hydrolyzes penicillins at a high level and cephalosporins and carbapenems at a very low level.
AMR Gene Family	SCO beta-lactamase
Drug Class	penicillin beta-lactam, cephalosporin
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^g, Acinetobacter radioresistens^wgs, Enterobacter hormaechei^wgs, Escherichia coli^p+wgs, Klebsiella michiganensis^wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Morganella morganii^wgs, Proteus mirabilis^wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^wgs, Salmonella enterica^wgs, Shigella flexneri^p
Resistomes with Sequence Variants	Acinetobacter baumannii^g, Acinetobacter radioresistens^wgs, Enterobacter cloacae^p, Enterobacter hormaechei^wgs, Escherichia coli^p+wgs, Klebsiella michiganensis^wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Morganella morganii^wgs, Proteus mirabilis^wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^wgs, Salmonella enterica^wgs, Shigella flexneri^p
Classification	18 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + beta-lactam antibiotic + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + penicillin beta-lactam [Drug Class] + beta-lactamase + cephalosporin [Drug Class] + penicillin with extended spectrum + fourth-generation cephalosporin + third-generation cephalosporin + second-generation cephalosporin + first-generation cephalosporin + class A beta-lactamase
Parent Term(s)	9 ontology terms \| Show + confers_resistance_to_antibiotic cefepime [Antibiotic] + confers_resistance_to_antibiotic ceftazidime [Antibiotic] + confers_resistance_to_antibiotic cefuroxime [Antibiotic] + confers_resistance_to_antibiotic amoxicillin [Antibiotic] + confers_resistance_to_antibiotic piperacillin [Antibiotic] + confers_resistance_to_antibiotic cefotaxime [Antibiotic] + confers_resistance_to_antibiotic cefalotin [Antibiotic] + confers_resistance_to_antibiotic ticarcillin [Antibiotic] + SCO beta-lactamase [AMR Gene Family]
Publications	Papagiannitsis CC, et al. 2011. Antimicrob. Agents Chemother. 55(1):376-81 Sequence of pR3521, an IncB plasmid from Escherichia coli encoding ACC-4, SCO-1, and TEM-1 beta-lactamases. (PMID 20956594) Poirel L, et al. 2007. Antimicrob. Agents Chemother. 51(6):2179-84 Identification of the novel narrow-spectrum beta-lactamase SCO-1 in Acinetobacter spp. from Argentina. (PMID 17420213) Papagiannitsis CC, et al. 2007. Antimicrob Agents Chemother 51(6): 2185-2188. SCO-1, a novel plasmid-mediated class A beta-lactamase with carbenicillinase characteristics from Escherichia coli. (PMID 17353248)

Resistomes

Prevalence of SCO-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	0.18%	0%	0%	0%	0%
Acinetobacter baumannii	0.18%	0%	0%	0%	0%
Acinetobacter radioresistens	0%	0%	3.51%	0%	0%
Acinetobacter radioresistens	0%	0%	3.51%	0%	0%
Enterobacter cloacae	0%	0.56%	0%	0%	0%
Enterobacter cloacae	0%	0%	0%	0%	0%
Enterobacter hormaechei	0%	0%	0.04%	0%	0%
Enterobacter hormaechei	0%	0%	0.04%	0%	0%
Escherichia coli	0%	0.01%	0.01%	0%	0%
Escherichia coli	0%	0.01%	0.01%	0%	0%
Klebsiella michiganensis	0%	0%	0.27%	0%	0%
Klebsiella michiganensis	0%	0%	0.27%	0%	0%
Klebsiella oxytoca	0%	0%	0.42%	0%	0%
Klebsiella oxytoca	0%	0%	0.42%	0%	0%
Klebsiella pneumoniae	0%	0.13%	0.73%	0%	0%
Klebsiella pneumoniae	0%	0.13%	0.7%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.39%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.39%	0%	0%
Morganella morganii	0%	0%	0.61%	0%	0%
Morganella morganii	0%	0%	0.61%	0%	0%
Proteus mirabilis	0%	0%	0.17%	0%	0%
Proteus mirabilis	0%	0%	0.17%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.07%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.07%	0%	0%
Salmonella enterica	0%	0%	0.02%	0%	0%
Salmonella enterica	0%	0%	0.02%	0%	0%
Shigella flexneri	0%	0.4%	0%	0%	0%
Shigella flexneri	0%	0.4%	0%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Type of Antibiotic Resistance: Acquired

Protein
DNA

>gb|ABL75133.1|+|SCO-1 [Acinetobacter baumannii]
MTRSALLIPLTTAAIALNAISPVYASDTHSIDDTVKQVETTLGAKVGIAVLDTGSQRAWFHRADDRFPMASTSKALTCAALLDKGQSFMN
KEALIKKADLDEYAPVTSGIVGKKVSAADLCSITMRTSDNTAVNKVLEILGGPQAVTAYLRKTGDNITRLDRNEPDLNEGTPGDVRDTTT
PRAILETLNKLVLGPTLGSDERKQLTTWLESNEVGDPLLRAGVPSDWRVADRTGAGGNGTRGVIAVMWPPKHAPIIAAIYITQTKATMEE
RNAAIASIGKAIAAEVLE

>gb|EF063111.1|+|1122-1988|SCO-1 [Acinetobacter baumannii]
ATGACAAGATCTGCCCTTTTGATTCCACTCACCACGGCGGCTATCGCGCTAAACGCAATATCGCCGGTTTATGCGAGCGACACCCATTCT
ATTGATGATACCGTAAAACAGGTTGAAACCACGCTGGGAGCAAAAGTGGGTATAGCCGTCCTGGACACCGGGTCTCAACGTGCCTGGTTC
CACCGTGCTGATGACCGTTTCCCGATGGCGAGCACATCCAAAGCTCTGACCTGTGCAGCGCTGTTGGATAAAGGTCAGAGCTTTATGAAT
AAAGAGGCCTTGATCAAAAAGGCGGACCTGGATGAATATGCACCAGTGACATCCGGCATAGTCGGCAAAAAAGTAAGTGCGGCTGACCTT
TGCAGCATTACCATGCGTACAAGTGACAATACCGCCGTCAACAAAGTTCTTGAAATCCTGGGAGGACCGCAAGCTGTAACCGCTTATTTG
CGCAAGACAGGTGATAACATTACTCGACTTGACAGAAATGAACCGGACCTCAACGAAGGAACGCCTGGAGACGTGCGCGACACGACAACG
CCTCGCGCTATTCTCGAAACACTTAATAAACTGGTACTGGGCCCCACTCTTGGCTCTGACGAGCGAAAACAACTCACAACCTGGCTTGAA
AGTAATGAGGTTGGTGACCCTTTGCTGCGCGCTGGAGTTCCTTCTGATTGGCGCGTCGCCGATCGAACTGGCGCTGGAGGTAACGGGACG
CGTGGGGTGATTGCCGTCATGTGGCCGCCAAAACACGCGCCAATCATTGCTGCGATTTACATTACACAGACGAAAGCCACTATGGAGGAA
AGGAACGCTGCCATCGCCTCTATTGGCAAAGCGATTGCTGCCGAAGTTCTGGAATAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

SCO-1

Prevalence: protein homolog model (view sequences)

Graph