VMB-1

Accession ARO:3005015
CARD Short NameVMB-1
DefinitionVibrio metallo-B-lactamase 1, also known as VMB-1, is carbapenemase beta-lactamase that is found in plasmid pVB1796 from Vibrio alginolyticus.
AMR Gene FamilyVMB beta-lactamase
Drug Classcarbapenem
Resistance Mechanismantibiotic inactivation
Resistomes with Sequence VariantsVibrio parahaemolyticuswgs
Classification13 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ confers_resistance_to_antibiotic amoxicillin [Antibiotic]
+ confers_resistance_to_antibiotic meropenem [Antibiotic]
+ confers_resistance_to_antibiotic imipenem [Antibiotic]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ confers_resistance_to_antibiotic cefotaxime [Antibiotic]
+ confers_resistance_to_antibiotic amoxicillin-clavulanic acid [Antibiotic+Adjuvant]
+ VMB beta-lactamase [AMR Gene Family]
Publications

Zheng Z, et al. 2020. Adv Biosyst 4(3):e1900221 Genetic and Biochemical Characterization of VMB-1, a Novel Metallo-β-Lactamase Encoded by a Conjugative, Broad-Host Range IncC Plasmid from Vibrio spp. (PMID 32293144)

Resistomes

Prevalence of VMB-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Vibrio parahaemolyticus0%0%0.12%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|QGQ32905.1|+|VMB-1 [Vibrio alginolyticus]
MKYIILFLLLIPSIVFANNEGTKELKLKKLSDNVYQHISYKRVEPWGLIGASGLVVINGTEAHMIDTPWTTQGTKQLIEWIEAKGLTIKS
AVVTHFHEDASGDIPLLNDLKIKTYATSLTNKLLKLNQKEVSSDEISSNTFEFIDGVASVFYPGAGHTEDNIVVWLPNEKILFGGCFVKS
LKNKNLGYTGDANISEWPNSMQKVINRYPDAKLVVPGHGEVGDVSLLKHTQALALSAAASNKKINKD


>gb|MN719868.1|+|13-756|VMB-1 [Vibrio alginolyticus]
ATGAAGTATATTATTCTATTCCTTCTCTTGATTCCTTCTATTGTATTTGCAAACAACGAAGGCACTAAAGAACTTAAATTAAAAAAGTTA
AGTGATAACGTTTATCAACATATTTCATATAAGAGGGTTGAGCCATGGGGTTTAATTGGAGCCTCAGGCTTAGTTGTTATTAATGGCACT
GAAGCACATATGATTGATACACCTTGGACAACCCAAGGAACAAAACAACTAATTGAATGGATTGAGGCTAAAGGTCTAACTATAAAAAGT
GCAGTAGTTACGCATTTTCATGAGGATGCTAGTGGTGATATACCACTTTTAAATGATTTGAAAATAAAAACGTATGCAACATCACTAACT
AATAAGCTTCTTAAATTAAACCAAAAAGAAGTGTCTAGTGATGAAATATCAAGTAATACCTTTGAATTTATTGATGGTGTTGCTAGTGTA
TTTTATCCCGGAGCGGGGCATACAGAGGATAATATTGTTGTTTGGCTACCTAATGAAAAGATATTGTTTGGAGGTTGTTTTGTAAAAAGC
CTTAAGAATAAAAATTTAGGTTATACAGGCGACGCAAATATTAGTGAATGGCCAAACTCTATGCAAAAAGTCATTAATCGTTATCCTGAT
GCCAAATTAGTTGTTCCAGGACATGGTGAAGTCGGAGATGTTAGCTTACTGAAGCATACTCAAGCATTAGCTTTGTCTGCAGCGGCCTCT
AACAAGAAAATCAACAAGGACTAA