OXA-1

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3001396
Synonym(s)OXA-30
CARD Short NameOXA-1
DefinitionOXA-1 is a beta-lactamase found in E. coli.
AMR Gene FamilyOXA-1-like beta-lactamase
Drug Classpenicillin beta-lactam, cephalosporin
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (36), Klebsiella pneumoniae (19), Salmonella (7), Enterobacteriaceae (7), Pseudomonas aeruginosa (6), Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 (5), Salmonella enterica (3), Shigella (2), Enterobacter cloacae (2)
GAZChina (2)
FOODONmeat (skinless) (3)
ENVOhospital (6)
UBERONmembrane organ (2), renal system (2), secretion of exocrine gland (2)
Classification18 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic amoxicillin [Antibiotic]
+ confers_resistance_to_antibiotic piperacillin [Antibiotic]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
+ OXA-1-like beta-lactamase [AMR Gene Family]
Sub-Term(s)
4 ontology terms | Show
+ SYN-1012 [Adjuvant] is_small_molecule_inhibitor_of
+ avibactam [Adjuvant] is_small_molecule_inhibitor_of
+ taniborbactam [Adjuvant] is_small_molecule_inhibitor_of
+ ARX1796 [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilag+p, Aeromonas veroniig, Avibacterium paragallinarumg+wgs, Citrobacter amalonaticusp+wgs, Citrobacter freundiig+p+wgs, Citrobacter koserip+wgs, Citrobacter portucalensisg+p+wgs, Citrobacter werkmaniiwgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniiwgs, Klebsiella aerogenesp+wgs, Klebsiella huaxiensisg, Klebsiella michiganensisp+wgs, Klebsiella oxytocag+p+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+p+wgs, Proteus mirabilisg+p+wgs, Proteus penneriwgs, Providencia alcalifaciensg, Providencia rettgerig+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella boydiiwgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+p+wgs, Shigella sonneiwgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilag+p, Aeromonas veroniig, Avibacterium paragallinarumg+wgs, Citrobacter amalonaticusp+wgs, Citrobacter freundiig+p+wgs, Citrobacter koserip+wgs, Citrobacter portucalensisg+p+wgs, Citrobacter werkmaniiwgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniiwgs, Klebsiella aerogenesp+wgs, Klebsiella huaxiensisg, Klebsiella michiganensisp+wgs, Klebsiella oxytocag+p+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+p+wgs, Pasteurella multocidag, Proteus mirabilisg+p+wgs, Proteus penneriwgs, Providencia alcalifaciensg, Providencia rettgerig+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella boydiiwgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+p+wgs, Shigella sonneiwgs, Vibrio choleraewgs
Publications

Ouellette M, et al. 1987. Proc Natl Acad Sci U S A 84(21): 7378-7382. Precise insertion of antibiotic resistance determinants into Tn21-like transposons: nucleotide sequence of the OXA-1 beta-lactamase gene. (PMID 2823258)

Tsang KK, et al. 2021. Microb Genom 7(1): Identifying novel β-lactamase substrate activity through in silico prediction of antimicrobial resistance. (PMID 33416461)

Resistomes

Prevalence of OXA-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.13%0%0%
Aeromonas caviae6.82%2.6%14.52%0%0%
Aeromonas hydrophila1.54%1.3%0%0%0%
Aeromonas veronii1.82%0%0%0%0%
Avibacterium paragallinarum12.5%0%2.94%0%0%
Citrobacter amalonaticus0%8.33%10.91%0%0%
Citrobacter freundii0.82%5.85%19.34%0%0%
Citrobacter koseri0%15%6.31%0%0%
Citrobacter portucalensis3.7%14.71%24.32%0%0%
Citrobacter werkmanii0%0%64.1%0%0%
Enterobacter asburiae0%0.83%8.3%0%0%
Enterobacter chengduensis0%0%16%0%0%
Enterobacter cloacae1.79%1.68%13.1%0%0%
Enterobacter hormaechei1.8%1.61%16.4%0%0%
Enterobacter kobei0%0.69%5.24%0%0%
Enterobacter roggenkampii0%0%1.08%0%0%
Escherichia coli1.07%0.53%7.36%0%0.22%
Escherichia fergusonii0%0%1.09%0%0%
Klebsiella aerogenes0%5.43%3.67%0%0%
Klebsiella huaxiensis100%0%0%0%0%
Klebsiella michiganensis0%9.14%12.23%0%0%
Klebsiella oxytoca2.56%3.42%4.2%0%0%
Klebsiella pneumoniae4.67%3.13%23.95%0%0%
Klebsiella quasipneumoniae0%1.48%12.11%0%0%
Morganella morganii23.08%2.5%19.63%0%0%
Pasteurella multocida0.71%0%0%0%0%
Proteus mirabilis27.52%6.25%26.9%0%0%
Proteus penneri0%0%25%0%0%
Providencia alcalifaciens18.18%0%0%0%0%
Providencia rettgeri8.82%0%3.82%0%0%
Providencia stuartii0%0%9.09%0%0%
Pseudomonas aeruginosa0.61%2.63%0.5%0%0%
Raoultella planticola0%6.98%17.95%0%0%
Salmonella enterica1.01%3.12%1.85%0%0%
Serratia marcescens0%1.29%3.93%0%0%
Shigella boydii0%0%5.56%0%0%
Shigella dysenteriae7.14%0%16.67%0%0%
Shigella flexneri38%1.2%77.95%0%0%
Shigella sonnei0%0%7.89%0%0%
Vibrio cholerae0%0%0.13%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AFB82783.1|-|OXA-1 [Klebsiella pneumoniae]
MKNTIHINFAIFLIIANIIYSSASASTDISTVASPLFEGTEGCFLLYDASTNAEIAQFNKAKCATQMAPDSTFKIALSLMAFDAEIIDQK
TIFKWDKTPKGMEIWNSNHTPKTWMQFSVVWVSQEITQKIGLNKIKNYLKDFDYGNQDFSGDKERNNGLTEAWLESSLKISPEEQIQFLR
KIINHNLPVKNSAIENTIENMYLQDLDNSTKLYGKTGAGFTANRTLQNGWFEGFIISKSGHKYVFVSALTGNLGSNLTSSIKAKKNAITI
LNTLNL


>gb|JN420336.1|-|1400-2230|OXA-1 [Klebsiella pneumoniae]
ATGAAAAACACAATACATATCAACTTCGCTATTTTTTTAATAATTGCAAATATTATCTACAGCAGCGCCAGTGCATCAACAGATATCTCT
ACTGTTGCATCTCCATTATTTGAAGGAACTGAAGGTTGTTTTTTACTTTACGATGCATCCACAAACGCTGAAATTGCTCAATTCAATAAA
GCAAAGTGTGCAACGCAAATGGCACCAGATTCAACTTTCAAGATCGCATTATCACTTATGGCATTTGATGCGGAAATAATAGATCAGAAA
ACCATATTCAAATGGGATAAAACCCCCAAAGGAATGGAGATCTGGAACAGCAATCATACACCAAAGACGTGGATGCAATTTTCTGTTGTT
TGGGTTTCGCAAGAAATAACCCAAAAAATTGGATTAAATAAAATCAAGAATTATCTCAAAGATTTTGATTATGGAAATCAAGACTTCTCT
GGAGATAAAGAAAGAAACAACGGATTAACAGAAGCATGGCTCGAAAGTAGCTTAAAAATTTCACCAGAAGAACAAATTCAATTCCTGCGT
AAAATTATTAATCACAATCTCCCAGTTAAAAACTCAGCCATAGAAAACACCATAGAGAACATGTATCTACAAGATCTGGATAATAGTACA
AAACTGTATGGGAAAACTGGTGCAGGATTCACAGCAAATAGAACCTTACAAAACGGATGGTTTGAAGGGTTTATTATAAGCAAATCAGGA
CATAAATATGTTTTTGTGTCCGCACTTACAGGAAACTTGGGGTCGAATTTAACATCAAGCATAAAAGCCAAGAAAAATGCGATCACCATT
CTAAACACACTAAATTTATAA

Curator Acknowledgements
Curator Description Most Recent Edit