OXA-1

Accession ARO:3001396
Synonym(s)OXA-30
DefinitionOXA-1 is a beta-lactamase found in E. coli
AMR Gene FamilyOXA beta-lactamase
Drug Classpenam, cephalosporin
Resistance Mechanismantibiotic inactivation
ResistomesCitrobacter amalonaticuswgs, Citrobacter freundiig+p+wgs, Citrobacter koseriwgs, Enterobacter asburiaewgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiig+p+wgs, Proteus mirabilisg+wgs, Providencia rettgerig+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Raoultella planticolawgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+p+wgs, Shigella sonneiwgs, Vibrio choleraewgs
Classification19 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic amoxicillin [Antibiotic]
+ confers_resistance_to_antibiotic piperacillin [Antibiotic]
+ OXA beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
+ confers_resistance_to_antibiotic piperacillin-tazobactam [Antibiotic]
Publications

Ouellette M, et al. 1987. Proc Natl Acad Sci U S A 84(21): 7378-7382. Precise insertion of antibiotic resistance determinants into Tn21-like transposons: nucleotide sequence of the OXA-1 beta-lactamase gene. (PMID 2823258)

Resistomes

Prevalence of OXA-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter amalonaticus0%0%15.62%
Citrobacter freundii2.63%2.83%13.38%
Citrobacter koseri0%0%3.45%
Enterobacter asburiae0%0%3.57%
Enterobacter cloacae4.65%3.45%8.2%
Enterobacter hormaechei3.23%4.4%18.7%
Enterobacter kobei0%0%4.35%
Escherichia coli0.66%0.85%5.87%
Klebsiella aerogenes0%2%1.88%
Klebsiella oxytoca0%3.33%1.95%
Klebsiella pneumoniae5.19%2.76%23.86%
Morganella morganii17.65%5.26%14.29%
Proteus mirabilis14.29%0%7.82%
Providencia rettgeri12.5%0%6.25%
Providencia stuartii0%0%4.17%
Pseudomonas aeruginosa1.15%5.77%0.29%
Raoultella planticola0%0%3.57%
Salmonella enterica1.09%2.16%0.86%
Serratia marcescens0%2.27%5.65%
Shigella dysenteriae8.33%0%11.76%
Shigella flexneri54.17%2.63%77.91%
Shigella sonnei0%0%6.99%
Vibrio cholerae0%0%0.16%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|AFB82783.1|-|OXA-1 [Klebsiella pneumoniae]
MKNTIHINFAIFLIIANIIYSSASASTDISTVASPLFEGTEGCFLLYDASTNAEIAQFNKAKCATQMAPDSTFKIALSLMAFDAEIIDQK
TIFKWDKTPKGMEIWNSNHTPKTWMQFSVVWVSQEITQKIGLNKIKNYLKDFDYGNQDFSGDKERNNGLTEAWLESSLKISPEEQIQFLR
KIINHNLPVKNSAIENTIENMYLQDLDNSTKLYGKTGAGFTANRTLQNGWFEGFIISKSGHKYVFVSALTGNLGSNLTSSIKAKKNAITI
LNTLNL


>gb|JN420336.1|-|1400-2230|OXA-1 [Klebsiella pneumoniae]
ATGAAAAACACAATACATATCAACTTCGCTATTTTTTTAATAATTGCAAATATTATCTACAGCAGCGCCAGTGCATCAACAGATATCTCT
ACTGTTGCATCTCCATTATTTGAAGGAACTGAAGGTTGTTTTTTACTTTACGATGCATCCACAAACGCTGAAATTGCTCAATTCAATAAA
GCAAAGTGTGCAACGCAAATGGCACCAGATTCAACTTTCAAGATCGCATTATCACTTATGGCATTTGATGCGGAAATAATAGATCAGAAA
ACCATATTCAAATGGGATAAAACCCCCAAAGGAATGGAGATCTGGAACAGCAATCATACACCAAAGACGTGGATGCAATTTTCTGTTGTT
TGGGTTTCGCAAGAAATAACCCAAAAAATTGGATTAAATAAAATCAAGAATTATCTCAAAGATTTTGATTATGGAAATCAAGACTTCTCT
GGAGATAAAGAAAGAAACAACGGATTAACAGAAGCATGGCTCGAAAGTAGCTTAAAAATTTCACCAGAAGAACAAATTCAATTCCTGCGT
AAAATTATTAATCACAATCTCCCAGTTAAAAACTCAGCCATAGAAAACACCATAGAGAACATGTATCTACAAGATCTGGATAATAGTACA
AAACTGTATGGGAAAACTGGTGCAGGATTCACAGCAAATAGAACCTTACAAAACGGATGGTTTGAAGGGTTTATTATAAGCAAATCAGGA
CATAAATATGTTTTTGTGTCCGCACTTACAGGAAACTTGGGGTCGAATTTAACATCAAGCATAAAAGCCAAGAAAAATGCGATCACCATT
CTAAACACACTAAATTTATAA