clbA

Accession ARO:3002814
DefinitionclbA is a plasmid-encoded cfr gene found in Bacillus velezensis (Bacillus amyloliquefaciens subsp. plantarum).
AMR Gene FamilyCfr 23S ribosomal RNA methyltransferase
Drug Classoxazolidinone antibiotic, streptogramin antibiotic, phenicol antibiotic, lincosamide antibiotic, macrolide antibiotic, pleuromutilin antibiotic
Resistance Mechanismantibiotic target alteration
Classification24 ontology terms | Show
Parent Term(s)11 ontology terms | Show
+ Cfr Group
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic tiamulin [Antibiotic]
+ confers_resistance_to_antibiotic dalfopristin [Antibiotic]
+ confers_resistance_to_antibiotic griseoviridin [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IIA [Antibiotic]
+ confers_resistance_to_antibiotic madumycin II [Antibiotic]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
Publications

Hansen LH, et al. 2012. Antimicrob Agents Chemother 56(7): 3563-3567. The order Bacillales hosts functional homologs of the worrisome cfr antibiotic resistance gene. (PMID 22547628)

Resistomes

Prevalence of clbA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Stenotrophomonas maltophilia0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 600


>gb|AGZ55247.1|+|clbA [Bacillus amyloliquefaciens CC178]
MQQKNKYIRIQEFLKQNKFPDFRMNQIKNAVFQGRINHFNEITVLPKSLRKLLIEEFGESILNIAPLKVQHSEQVTKVLFEISGDEKIET
VNMKYKAGWESFCISSQCGCHFGCKFCATGDIGLKRNLTSDEMTDQILYFHLKGHSIDSISFMGMGEALANVQVFDALHVLTNPELFALS
PRRLSISTIGIIPGIKKITQDYPQVNLTFSLHSPFNEQRSKLMPINERYPLLEVMDTLDEHIRVTSRKVYIAYIMLPGVNDSIDHANEVV
NLLRSRYKRGNLFHVNIIRYNPTVSSPMRFEEVNEKQVVNFYKKLKSAGINVTVRSQFGIDIDAACGQLYGNYQKNKNQ


>gb|CP006845.1|+|539696-540745|clbA [Bacillus amyloliquefaciens CC178]
ATGCAACAAAAAAACAAGTATATAAGAATCCAAGAGTTCCTGAAGCAAAATAAATTTCCTGATTTTAGAATGAATCAAATCAAAAATGCT
GTATTCCAAGGGAGAATAAATCATTTCAATGAAATAACGGTTCTTCCTAAATCCCTGAGAAAATTGTTAATAGAGGAGTTCGGAGAGTCG
ATTTTAAATATTGCTCCTTTAAAAGTGCAGCATTCTGAGCAAGTAACAAAAGTCTTATTTGAAATTTCCGGAGACGAAAAAATAGAAACG
GTTAATATGAAATATAAAGCCGGTTGGGAGTCATTTTGTATATCCTCGCAGTGCGGCTGTCATTTCGGCTGTAAATTTTGTGCAACAGGA
GATATTGGTTTAAAACGCAATTTAACGTCAGATGAAATGACTGACCAAATTTTGTACTTTCACTTAAAAGGACATTCAATTGACAGTATT
TCTTTTATGGGAATGGGAGAAGCATTAGCGAATGTACAAGTTTTTGATGCTTTACATGTGCTTACAAATCCGGAGTTGTTTGCTTTAAGC
CCTCGCAGGTTATCTATTTCGACTATAGGTATTATTCCGGGCATTAAAAAAATCACTCAGGATTATCCGCAGGTCAACCTGACGTTTTCA
TTACATTCTCCTTTTAATGAACAGCGAAGCAAGTTAATGCCGATTAATGAACGCTACCCGTTATTGGAGGTAATGGACACATTAGATGAG
CATATACGTGTGACCTCAAGAAAAGTTTATATTGCTTATATTATGCTGCCGGGAGTTAATGATTCTATTGATCATGCGAATGAAGTAGTA
AATCTTTTAAGAAGCAGATATAAGAGAGGGAACTTGTTCCATGTAAACATCATTAGATATAACCCGACTGTTAGTTCACCTATGAGATTT
GAAGAAGTAAATGAGAAACAAGTTGTAAACTTCTATAAAAAATTAAAGTCAGCAGGAATTAACGTGACCGTCAGAAGTCAATTTGGTATT
GATATAGATGCTGCTTGCGGACAATTATATGGAAATTATCAAAAAAATAAGAACCAATAA