clbC

Accession ARO:3002816
DefinitionclbC is a plasmid-encoded cfr gene found in Bacillus clausii
AMR Gene FamilyCfr 23S ribosomal RNA methyltransferase
Drug Classoxazolidinone antibiotic, macrolide antibiotic, streptogramin antibiotic, lincosamide antibiotic, phenicol antibiotic, pleuromutilin antibiotic
Resistance Mechanismantibiotic target alteration
Classification24 ontology terms | Show
Parent Term(s)11 ontology terms | Show
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic tiamulin [Antibiotic]
+ confers_resistance_to_antibiotic dalfopristin [Antibiotic]
+ confers_resistance_to_antibiotic griseoviridin [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IIA [Antibiotic]
+ confers_resistance_to_antibiotic madumycin II [Antibiotic]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
+ Cfr Group
Publications

Hansen LH, et al. 2012. Antimicrob Agents Chemother 56(7): 3563-3567. The order Bacillales hosts functional homologs of the worrisome cfr antibiotic resistance gene. (PMID 22547628)

Resistomes

Prevalence of clbC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 600


>gb|BAD63613.1|+|clbC [Bacillus clausii KSM-K16]
MKVVNHATKYERLKHFLNALNEPTYRYKQITEAIFKHRIGAFNKMTTLPKALRESLINEFGPSILTVEPVLETTSQQVTKVLLKVAGNNQ
VEAVRMHYEAGWESFCISSQCGCGLGCTFCSTGAIGLKQNLSADEMTDQLLYFYLKGHSLDSVSFMGMGEALANVRIFDALNVLVDRQLF
ALSPRRITVSTVGIIPNIQRMTSSFPQMNLTFSLHSPFHDQRSELMPINNKYPLDQVMNVLDQHIHETGRKVYIAYVMLRGVNDSEKHAE
ALVKRILNNRYPHLYHVNLIRYNPTVGTPENYGQTIEEKLQTFYRVVKSARIPVTIRSQFGREIDAACGQLYGQYQAKKR


>gb|AP006627.1|+|1162418-1163470|clbC [Bacillus clausii KSM-K16]
ATGAAAGTTGTCAATCATGCGACAAAATACGAACGATTAAAACATTTTTTGAATGCTTTAAATGAACCAACGTACCGGTATAAACAGATT
ACTGAAGCGATTTTCAAACATCGTATTGGTGCGTTTAATAAAATGACCACATTGCCAAAAGCACTGAGAGAATCGCTCATAAACGAATTT
GGTCCTTCCATCCTTACAGTAGAGCCGGTGCTAGAAACAACGTCTCAACAAGTCACTAAAGTGTTGCTAAAAGTAGCGGGAAACAATCAA
GTGGAAGCCGTAAGAATGCATTATGAAGCAGGGTGGGAGTCGTTTTGCATTTCTTCTCAATGTGGCTGTGGGTTAGGGTGTACGTTTTGT
TCGACAGGAGCCATTGGGTTAAAACAAAACTTATCAGCAGACGAGATGACAGACCAGTTGCTCTATTTTTATCTGAAGGGGCATTCCTTA
GATAGTGTCTCTTTTATGGGCATGGGCGAAGCGCTAGCCAATGTAAGGATATTTGATGCTTTGAATGTGCTTGTCGATCGGCAACTATTT
GCATTAAGTCCTAGAAGAATAACGGTCTCTACGGTTGGCATCATACCAAACATCCAAAGAATGACTAGCAGCTTTCCTCAGATGAACCTA
ACGTTTTCACTGCACTCTCCTTTTCATGATCAGCGCAGCGAGTTGATGCCGATTAACAACAAGTACCCGTTAGACCAGGTAATGAATGTA
TTGGATCAGCATATTCACGAGACAGGGAGAAAAGTATATATTGCTTATGTCATGCTTCGGGGTGTCAATGATTCGGAGAAACATGCAGAA
GCACTTGTTAAACGGATTCTAAACAATCGCTATCCCCATCTCTATCATGTCAATTTGATTCGCTACAATCCGACTGTGGGTACGCCTGAA
AACTATGGCCAAACCATAGAAGAGAAACTGCAAACTTTTTACCGTGTCGTAAAATCAGCTCGAATTCCTGTAACGATTCGGAGTCAATTT
GGAAGAGAAATTGATGCCGCCTGCGGCCAATTATATGGTCAGTATCAGGCGAAAAAAAGGTGA