cfrA

Accession ARO:3003441
Synonym(s)cfr cfr(A)
DefinitionCfrA is a chloramphenicol-florfenicol resistance gene and methyltransferase enzyme. Methylation of position 8 of A2503 in 23S rRNA confers resistance to chloramphenicol antibiotics first identified by Schwarz 2000 as cfr from Staphylococcus sciuri. Additional Oxazolidinone resistance mediated by the cfr gene in a human isolated was first reported from Colombia in linezolid- and methicillin-resistant Staphylococcus aureus (PMID: 10952608). Described by Arias et al. 2008. Chandela T. et al. (PMID: 28663118) grouped Cfr with ClbA in the Cfr Group.
AMR Gene FamilyCfr 23S ribosomal RNA methyltransferase
Drug Classoxazolidinone antibiotic, phenicol antibiotic, macrolide antibiotic, streptogramin antibiotic, lincosamide antibiotic, pleuromutilin antibiotic
Resistance Mechanismantibiotic target alteration
ResistomesEnterococcus faecaliswgs, Enterococcus faeciump, Staphylococcus aureusp+wgs
Classification24 ontology terms | Show
Parent Term(s)11 ontology terms | Show
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic tiamulin [Antibiotic]
+ confers_resistance_to_antibiotic dalfopristin [Antibiotic]
+ confers_resistance_to_antibiotic griseoviridin [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IIA [Antibiotic]
+ confers_resistance_to_antibiotic madumycin II [Antibiotic]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
+ Cfr Group
Publications

Kehrenberg C, et al. 2007. Antimicrob Agents Chemother 51(2): 483-487. IS21-558 insertion sequences are involved in the mobility of the multiresistance gene cfr. (PMID 17145796)

Arias CA, et al. 2008. J Clin Microbiol 46(3): 892-896. Clinical and microbiological aspects of linezolid resistance mediated by the cfr gene encoding a 23S rRNA methyltransferase. (PMID 18174304)

Mukhtar TA and Wright GD. 2005. Chem Rev 105(2): 529-542. Streptogramins, oxazolidinones, and other inhibitors of bacterial protein synthesis. (PMID 15700955)

Schwarz S, et al. 2000. Antimicrob Agents Chemother 44(9): 2530-2533. Identification of a plasmid-borne chloramphenicol-florfenicol resistance gene in Staphylococcus sciuri. (PMID 10952608)

Candela T, et al. 2017. Int. J. Antimicrob. Agents 50(3):496-500 A cfr-Like Gene cfr(C) Conferring Linezolid Resistance is Common in Clostridium difficile. (PMID 28663118)

Resistomes

Prevalence of cfrA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterococcus faecalis0%0.88%0.13%
Enterococcus faecium0%0.18%0%
Proteus mirabilis4.35%0%0%
Staphylococcus aureus0.24%0.08%0.08%
Staphylococcus epidermidis0%0%3.49%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 600


>gb|CAL64019.1|-|cfrA [Staphylococcus warneri]
MNFNNKTKYGKIQEFLRSNNEPDYRIKQITNAIFKQRISRFEDMKVLPKLLREDLINNFGETVLNIKLLAEQNSEQVTKVLFEVSKNERV
ETVNMKYKAGWESFCISSQCGCNFGCKFCATGDIGLKKNLTVDEITDQVLYFHLLGHQIDSISFMGMGEALANRQVFDALDSFTDPNLFA
LSPRRLSISTIGIIPSIKKITQEYPQVNLTFSLHSPYSEERSKLMPINDRYPIDEVMNILDEHIRLTSRKVYIAYIMLPGVNDSLEHANE
VVSLLKSRYKSGKLYHVNLIRYNPTISAPEMYGEANEGQVEAFYKVLKSAGIHVTIRSQFGIDIDAACGQLYGNYQNSQ


>gb|AM408573|-|10028-11077|cfrA [Staphylococcus warneri]
ATGAATTTTAATAATAAAACAAAGTATGGTAAAATACAGGAATTTTTAAGAAGTAATAATGAGCCTGATTATAGAATAAAACAAATAACC
AATGCGATTTTTAAACAAAGAATTAGTCGATTTGAGGATATGAAGGTTCTTCCAAAATTACTTAGGGAGGATTTAATAAATAATTTTGGA
GAAACAGTTTTGAATATCAAGCTCTTAGCAGAGCAAAATTCAGAGCAAGTTACGAAAGTGCTTTTTGAAGTATCAAAGAATGAGAGAGTA
GAAACGGTAAACATGAAGTATAAAGCAGGTTGGGAGTCATTTTGTATATCATCACAATGCGGATGTAATTTTGGGTGTAAATTTTGTGCT
ACAGGCGACATTGGATTGAAAAAAAACCTAACTGTAGATGAGATAACAGATCAAGTTTTATACTTCCATTTATTAGGTCATCAAATTGAT
AGCATTTCTTTTATGGGAATGGGTGAAGCTCTAGCCAACCGTCAAGTATTTGATGCTCTTGATTCGTTTACGGATCCTAATTTATTTGCA
TTAAGTCCTCGTAGACTTTCTATATCAACGATTGGTATTATACCTAGTATCAAAAAAATAACCCAGGAATATCCTCAAGTAAATCTTACA
TTTTCATTACACTCACCTTATAGTGAGGAACGCAGCAAATTGATGCCAATAAATGATAGATACCCAATAGATGAGGTAATGAATATACTC
GATGAACATATAAGATTAACTTCAAGGAAAGTATATATAGCTTATATCATGTTGCCTGGTGTAAATGATTCTCTTGAGCATGCAAACGAA
GTTGTTAGCCTTCTTAAAAGTCGCTATAAATCAGGGAAGTTATATCATGTAAATTTGATACGATACAATCCTACAATAAGTGCACCTGAG
ATGTATGGAGAAGCAAACGAAGGGCAGGTAGAAGCCTTTTACAAAGTTTTGAAGTCTGCTGGTATCCATGTCACAATTAGAAGTCAATTT
GGGATTGATATTGACGCTGCTTGTGGTCAATTATATGGTAATTATCAAAATAGCCAATAG