cfrA

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003441
Synonym(s)cfr cfr(A)
CARD Short NamecfrA
DefinitionCfrA is a chloramphenicol-florfenicol resistance gene and methyltransferase enzyme. Methylation of position 8 of A2503 in 23S rRNA confers resistance to chloramphenicol antibiotics first identified by Schwarz 2000 as cfr from Mammaliicoccus sciuri. Additional Oxazolidinone resistance mediated by the cfr gene in a human isolated was first reported from Colombia in linezolid- and methicillin-resistant Staphylococcus aureus.
AMR Gene FamilyCfr-like 23S rRNA methyltransferase
Drug Classphenicol antibiotic, oxazolidinone antibiotic, streptogramin antibiotic, lincosamide antibiotic, pleuromutilin antibiotic
Resistance Mechanismantibiotic target alteration
Classification17 ontology terms | Show
Parent Term(s)11 ontology terms | Show
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ confers_resistance_to_antibiotic azidamfenicol [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic thiamphenicol [Antibiotic]
+ confers_resistance_to_antibiotic virginiamycin M1 [Antibiotic]
+ confers_resistance_to_antibiotic tiamulin [Antibiotic]
+ confers_resistance_to_antibiotic madumycin II [Antibiotic]
+ confers_resistance_to_antibiotic griseoviridin [Antibiotic]
+ confers_resistance_to_antibiotic dalfopristin [Antibiotic]
+ Cfr Group
Resistomes with Perfect MatchesEnterococcus faecalisp+wgs, Enterococcus faeciump, Klebsiella quasipneumoniaep, Staphylococcus arlettaep+wgs, Staphylococcus aureusg+p+wgs, Staphylococcus capitiswgs, Staphylococcus epidermidiswgs, Staphylococcus hominiswgs, Staphylococcus saprophyticusp+wgs
Resistomes with Sequence VariantsEnterococcus faecalisg+p+wgs, Enterococcus faeciump, Escherichia colip+wgs, Klebsiella aerogeneswgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatap, Morganella morganiiwgs, Proteus mirabilisg+p+wgs+gi, Proteus vulgarisp, Providencia rettgerip+wgs, Salmonella entericawgs, Staphylococcus arlettaep+wgs, Staphylococcus aureusg+p+wgs+gi, Staphylococcus capitisg+wgs, Staphylococcus epidermidiswgs, Staphylococcus haemolyticusg+wgs+gi, Staphylococcus hominiswgs, Staphylococcus saprophyticusp+wgs, Streptococcus suisg+wgs
Publications

Kehrenberg C, et al. 2007. Antimicrob Agents Chemother 51(2): 483-487. IS21-558 insertion sequences are involved in the mobility of the multiresistance gene cfr. (PMID 17145796)

Arias CA, et al. 2008. J Clin Microbiol 46(3): 892-896. Clinical and microbiological aspects of linezolid resistance mediated by the cfr gene encoding a 23S rRNA methyltransferase. (PMID 18174304)

Mukhtar TA and Wright GD. 2005. Chem Rev 105(2): 529-542. Streptogramins, oxazolidinones, and other inhibitors of bacterial protein synthesis. (PMID 15700955)

Schwarz S, et al. 2000. Antimicrob Agents Chemother 44(9): 2530-2533. Identification of a plasmid-borne chloramphenicol-florfenicol resistance gene in Staphylococcus sciuri. (PMID 10952608)

Candela T, et al. 2017. Int. J. Antimicrob. Agents 50(3):496-500 A cfr-Like Gene cfr(C) Conferring Linezolid Resistance is Common in Clostridium difficile. (PMID 28663118)

Resistomes

Prevalence of cfrA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Enterococcus faecalis0.45%1.48%0.16%0%0%
Enterococcus faecium0%0.06%0%0%0%
Escherichia coli0%0.02%0.05%0%0%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella pneumoniae0%0.01%0.01%0%0%
Klebsiella quasipneumoniae0%0.21%0.13%0%0%
Leclercia adecarboxylata0%4.76%0%0%0%
Morganella morganii0%0%0.61%0%0%
Proteus mirabilis2.75%1.25%0.99%7.41%0%
Proteus vulgaris0%22.22%0%0%0%
Providencia rettgeri0%2.7%0.64%0%0%
Salmonella enterica0%0%0.01%0%0%
Staphylococcus arlettae0%8.33%2.5%0%0%
Staphylococcus aureus0.09%0.45%0.31%0.29%0%
Staphylococcus capitis10%0%10.76%0%0%
Staphylococcus epidermidis0%0%1.67%0%0%
Staphylococcus haemolyticus6.9%0%0.22%13.33%0%
Staphylococcus hominis0%0%0.49%0%0%
Staphylococcus saprophyticus0%2.7%0.7%0%0%
Streptococcus suis0.8%0%0.05%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 600


>gb|CAL64019.1|-|cfrA [Staphylococcus warneri]
MNFNNKTKYGKIQEFLRSNNEPDYRIKQITNAIFKQRISRFEDMKVLPKLLREDLINNFGETVLNIKLLAEQNSEQVTKVLFEVSKNERV
ETVNMKYKAGWESFCISSQCGCNFGCKFCATGDIGLKKNLTVDEITDQVLYFHLLGHQIDSISFMGMGEALANRQVFDALDSFTDPNLFA
LSPRRLSISTIGIIPSIKKITQEYPQVNLTFSLHSPYSEERSKLMPINDRYPIDEVMNILDEHIRLTSRKVYIAYIMLPGVNDSLEHANE
VVSLLKSRYKSGKLYHVNLIRYNPTISAPEMYGEANEGQVEAFYKVLKSAGIHVTIRSQFGIDIDAACGQLYGNYQNSQ


>gb|AM408573.1|-|10028-11077|cfrA [Staphylococcus warneri]
ATGAATTTTAATAATAAAACAAAGTATGGTAAAATACAGGAATTTTTAAGAAGTAATAATGAGCCTGATTATAGAATAAAACAAATAACC
AATGCGATTTTTAAACAAAGAATTAGTCGATTTGAGGATATGAAGGTTCTTCCAAAATTACTTAGGGAGGATTTAATAAATAATTTTGGA
GAAACAGTTTTGAATATCAAGCTCTTAGCAGAGCAAAATTCAGAGCAAGTTACGAAAGTGCTTTTTGAAGTATCAAAGAATGAGAGAGTA
GAAACGGTAAACATGAAGTATAAAGCAGGTTGGGAGTCATTTTGTATATCATCACAATGCGGATGTAATTTTGGGTGTAAATTTTGTGCT
ACAGGCGACATTGGATTGAAAAAAAACCTAACTGTAGATGAGATAACAGATCAAGTTTTATACTTCCATTTATTAGGTCATCAAATTGAT
AGCATTTCTTTTATGGGAATGGGTGAAGCTCTAGCCAACCGTCAAGTATTTGATGCTCTTGATTCGTTTACGGATCCTAATTTATTTGCA
TTAAGTCCTCGTAGACTTTCTATATCAACGATTGGTATTATACCTAGTATCAAAAAAATAACCCAGGAATATCCTCAAGTAAATCTTACA
TTTTCATTACACTCACCTTATAGTGAGGAACGCAGCAAATTGATGCCAATAAATGATAGATACCCAATAGATGAGGTAATGAATATACTC
GATGAACATATAAGATTAACTTCAAGGAAAGTATATATAGCTTATATCATGTTGCCTGGTGTAAATGATTCTCTTGAGCATGCAAACGAA
GTTGTTAGCCTTCTTAAAAGTCGCTATAAATCAGGGAAGTTATATCATGTAAATTTGATACGATACAATCCTACAATAAGTGCACCTGAG
ATGTATGGAGAAGCAAACGAAGGGCAGGTAGAAGCCTTTTACAAAGTTTTGAAGTCTGCTGGTATCCATGTCACAATTAGAAGTCAATTT
GGGATTGATATTGACGCTGCTTGTGGTCAATTATATGGTAATTATCAAAATAGCCAATAG

Curator Acknowledgements
Curator Description Most Recent Edit