baeS

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000829
CARD Short NamebaeS
DefinitionBaeS is a sensor kinase in the BaeSR regulatory system. While it phosphorylates BaeR to increase its activity, BaeS is not necessary for overexpressed BaeR to confer resistance.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classaminocoumarin antibiotic, aminoglycoside antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification21 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Resistomes with Perfect MatchesEscherichia colig+wgs, Escherichia marmotaewgs, Shigella boydiig+wgs, Shigella dysenteriaewgs, Shigella flexnerig+wgs, Shigella sonneig+wgs
Resistomes with Sequence VariantsCitrobacter amalonaticusg+wgs, Citrobacter freundiig, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+p+wgs, Escherichia marmotaeg+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs
Publications

Baranova N and Nikaido H. 2002. J Bacteriol 184(15): 4168-4176. The baeSR two-component regulatory system activates transcription of the yegMNOB (mdtABCD) transporter gene cluster in Escherichia coli and increases its resistance to novobiocin and deoxycholate. (PMID 12107134)

Nishino K, et al. 2005. J Bacteriol 187(5): 1763-1772. Genome-wide analyses of Escherichia coli gene expression responsive to the BaeSR two-component regulatory system. (PMID 15716448)

Liu X, et al. 2023. mSystems :e0129122 Mutation in the two-component regulator BaeSR mediates cefiderocol resistance and enhances virulence in Acinetobacter baumannii. (PMID 37345941)

Resistomes

Prevalence of baeS among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein overexpression model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter amalonaticus18.18%0%43.64%0%0%
Citrobacter freundii1.64%0%0%0%0%
Escherichia albertii100%0%99.35%0%0%
Escherichia coli67.41%0.04%99.06%0%0%
Escherichia fergusonii100%0.36%97.83%0%0%
Escherichia marmotae100%0%97.92%0%0%
Shigella boydii100%0%98.89%0%0%
Shigella dysenteriae100%0%96.67%0%0%
Shigella flexneri100%0%94.41%0%0%
Shigella sonnei100%0%97.44%0%0%
Show Perfect Only


Detection Models

Model Type: protein overexpression model

Model Definition: Protein Overexpression Models (POM) are similar to Protein Variant Models (PVM) in that they include a protein reference sequence, a curated BLASTP bitscore cut-off, and mapped resistance variants. Whereas PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, reporting only those with curated mutations conferring AMR, POMs are restricted to regulatory proteins and report both wild-type sequences and/or sequences with mutations leading to overexpression of efflux complexes. The former lead to efflux of antibiotics at basal levels, while the latter can confer clinical resistance. POMs include a protein reference sequence (often from wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Perfect RGI match is 100% identical to the wild-type reference protein sequence along its entire length, a Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value may or may not contain at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off may or may not contain at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 850

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
D89Vsingle resistance variantPMID:37345941

>gb|ADF62939.1|+|baeS [Enterobacter cloacae subsp. cloacae ATCC 13047]
MKFWRPGITGKLFLAIFATCIVLLITMHWAVRLSFERGFIDYIKHGNEQRLQGLSDALSE
QYAQHGNWRFLRNNDRFIFQILRSLEHDSGDDRPGPGMPPHGWRTQFWVIDQDMRTLVGP
RAPIPPDGTRRAIKVNNATVGWVIASPVERLTRNTDINFDRQQRRASWLIVILSTLLAAL
ATFPLARGLLAPVKRLVEGTHKLAAGDFSTRVDTRSQDELGKLAQDFNQLASTLEKNQQM
RRDFMADISHELRTPLAVLRGELEAIQDGVRKFTPESVASLQAEVGTLTKLVDDLHQLSM
SDEGALAYQKAPVDVINILEVISGAFRERFASRNLTIDLSLPDSAVVFGDKDRLMQLFNN
LLENSLRYTDSGGGLHISGKQENGRFALTFADSAPGVQDAQLEKLFERFYRTEGSRNRAS
GGSGLGLAICVNIVEAHNGTLRAAHSPFGGVSITVELPLERDLSREA



>gb|CP001918.1|+|3478460-3479863|baeS [Enterobacter cloacae subsp. cloacae ATCC 13047]
ATGAAATTCTGGCGTCCGGGCATTACCGGTAAGCTCTTTCTGGCAATTTTTGCCACCTGTATTGTCCTGCTGATCACCATGCACTGGGCC
GTACGGCTCAGCTTTGAGCGCGGTTTTATCGATTACATTAAGCATGGTAATGAGCAGCGCCTGCAGGGTTTGAGCGATGCACTGAGCGAG
CAGTATGCCCAGCACGGGAACTGGCGTTTTTTACGCAACAATGACCGTTTTATCTTCCAGATCCTGCGCTCGCTGGAGCACGATAGCGGC
GATGACCGCCCCGGCCCGGGCATGCCACCCCATGGCTGGCGCACCCAGTTCTGGGTGATCGACCAGGATATGCGCACGCTGGTTGGCCCT
CGTGCGCCCATCCCCCCGGACGGCACCCGGCGGGCAATCAAAGTGAATAACGCTACCGTCGGCTGGGTTATCGCCTCGCCAGTGGAACGC
CTGACGCGCAACACCGATATCAACTTCGATCGTCAGCAGCGCCGGGCCAGTTGGCTGATCGTCATCCTCTCCACGCTGCTGGCCGCGCTT
GCCACCTTCCCGCTGGCGCGGGGCCTGCTCGCCCCGGTGAAAAGGCTGGTGGAAGGCACGCATAAACTGGCCGCCGGGGATTTTTCCACC
CGCGTGGACACGCGCAGCCAGGATGAGCTGGGCAAGCTGGCGCAGGATTTTAACCAGCTCGCCAGTACGCTGGAGAAAAACCAGCAGATG
CGGCGCGATTTTATGGCCGATATTTCACACGAGCTGCGCACCCCGCTGGCAGTGCTGCGCGGCGAACTGGAGGCCATTCAGGACGGCGTG
CGCAAGTTCACGCCCGAATCCGTGGCTTCGCTGCAGGCGGAAGTGGGTACGCTGACCAAACTGGTAGACGATCTGCACCAGCTCTCTATG
TCAGACGAAGGGGCGCTGGCCTACCAGAAAGCACCGGTGGACGTAATCAACATTCTGGAGGTCATCAGCGGGGCTTTCCGCGAACGTTTT
GCCAGCCGCAACCTGACCATTGACCTCTCCCTGCCGGACAGCGCGGTGGTGTTTGGCGATAAAGATCGTCTGATGCAGCTCTTCAACAAC
CTGCTGGAAAACAGCCTGCGATACACCGACAGCGGTGGCGGACTACACATCTCCGGCAAACAGGAAAACGGCCGCTTCGCCCTCACCTTT
GCCGACTCCGCTCCCGGCGTGCAGGATGCGCAGCTGGAAAAACTGTTTGAACGTTTTTATCGCACCGAAGGCTCCCGCAACCGTGCCAGC
GGCGGCTCCGGGCTGGGACTGGCGATTTGCGTTAATATCGTCGAGGCGCACAATGGCACCCTGCGTGCCGCCCATTCGCCTTTTGGCGGG
GTTAGCATTACAGTAGAGTTACCGCTGGAACGGGATTTATCGAGAGAAGCATGA

Curator Acknowledgements
Curator Description Most Recent Edit