CMY-2

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002013
Synonym(s)BIL-1, LAT-2
CARD Short NameCMY-2
DefinitionCMY-2 is a beta-lactamase found in Klebsiella pneumoniae.
AMR Gene FamilyCMY beta-lactamase
Drug Classpenicillin beta-lactam, cephalosporin, carbapenem
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (159), Salmonella (45), Klebsiella pneumoniae (30), Salmonella enterica (17), Enterobacteriaceae (12), Citrobacter freundii (11), Proteus mirabilis (11), Klebsiella (6), Enterobacter cloacae (5), Enterobacter (5)
GAZRepublic of China (7), Unity State (7), China (6), Brazil (4), Canada (4), South Korea (4), Kingdom of Spain (3), Germany (3), Japan (3), Europe (3)
FOODONchicken (18), poultry drumstick (11), meat (skinless) (10), Bos taurus (8), swine (7), water food product (4), turkey (bird) (3), poultry meat (3), pork meat food product (2)
ENVOfarm (8), hospital (4)
UBERONfeces (14), animal hemisphere (13), membrane organ (5), urine (2)
Classification21 ontology terms | Show
Parent Term(s)9 ontology terms | Show
+ confers_resistance_to_antibiotic cefoxitin [Antibiotic]
+ confers_resistance_to_antibiotic cefazolin [Antibiotic]
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ confers_resistance_to_antibiotic ertapenem [Antibiotic]
+ CMY beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ confers_resistance_to_antibiotic cefixime [Antibiotic]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
Sub-Term(s)
3 ontology terms | Show
+ vaborbactam [Adjuvant] is_small_molecule_inhibitor_of
+ taniborbactam [Adjuvant] is_small_molecule_inhibitor_of
+ nacubactam [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesAeromonas hydrophilap, Citrobacter freundiig+p+wgs, Citrobacter portucalensisg+wgs, Escherichia albertiiwgs, Escherichia colig+p+wgs+gi, Klebsiella aerogeneswgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabilisg+wgs, Proteus vulgariswgs, Providencia rettgeriwgs, Providencia stuartiip, Salmonella entericag+p+wgs+gi, Shigella boydiiwgs, Shigella flexneriwgs, Shigella sonneiwgs, Vibrio choleraep+wgs
Resistomes with Sequence VariantsAeromonas hydrophilap, Citrobacter freundiig+p+wgs, Citrobacter portucalensisg+wgs, Escherichia albertiiwgs, Escherichia colig+p+wgs+gi, Klebsiella aerogeneswgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabilisg+wgs, Proteus vulgariswgs, Providencia rettgeriwgs, Providencia stuartiip, Salmonella entericag+p+wgs+gi, Shigella boydiiwgs, Shigella flexneriwgs, Shigella sonneiwgs, Vibrio choleraep+wgs
Publications

Bauernfeind A, et al. 1996. Antimicrob Agents Chemother 40(1): 221-224. Characterization of the plasmidic beta-lactamase CMY-2, which is responsible for cephamycin resistance. (PMID 8787910)

Tsang KK, et al. 2021. Microb Genom 7(1): Identifying novel β-lactamase substrate activity through in silico prediction of antimicrobial resistance. (PMID 33416461)

Resistomes

Prevalence of CMY-2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas hydrophila0%2.6%0%0%0%
Citrobacter freundii0.82%0.31%0.58%0%0%
Citrobacter portucalensis3.7%0%11.71%0%0%
Escherichia albertii0%0%0.65%0%0%
Escherichia coli1.29%0.52%4.05%1.79%30.32%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella pneumoniae0%0.16%0.34%0%0%
Klebsiella quasipneumoniae0%0.21%0.66%0%0%
Proteus mirabilis9.17%0%3.96%0%0%
Proteus vulgaris0%0%5.56%0%0%
Providencia rettgeri0%0%3.18%0%0%
Providencia stuartii0%2.27%0%0%0%
Salmonella enterica0.44%6.13%5.5%0.33%0%
Shigella boydii0%0%3.33%0%0%
Shigella flexneri0%0%0.16%0%0%
Shigella sonnei0%0%0.22%0%0%
Vibrio cholerae0%5.26%0.13%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700


>gb|CAA62957.1|+|CMY-2 [Klebsiella pneumoniae]
MMKKSLCCALLLTASFSTFAAAKTEQQIADIVNRTITPLMQEQAIPGMAVAVIYQGKPYYFTWGKADIANNHPVTQQTLFELGSVSKTFN
GVLGGDAIARGEIKLSDPVTKYWPELTGKQWQGIRLLHLATYTAGGLPLQIPDDVRDKAALLHFYQNWQPQWTPGAKRLYANSSIGLFGA
LAVKPSGMSYEEAMTRRVLQPLKLAHTWITVPQNEQKDYAWGYREGKPVHVSPGQLDAEAYGVKSSVIDMARWVQANMDASHVQEKTLQQ
GIALAQSRYWRIGDMYQGLGWEMLNWPLKADSIINGSDSKVALAALPAVEVNPPAPAVKASWVHKTGSTGGFGSYVAFVPEKNLGIVMLA
NKSYPNPVRVEAAWRILEKLQ


>gb|X91840.1|+|1-1146|CMY-2 [Klebsiella pneumoniae]
ATGATGAAAAAATCGTTATGCTGCGCTCTGCTGCTGACAGCCTCTTTCTCCACATTTGCTGCCGCAAAAACAGAACAACAGATTGCCGAT
ATCGTTAATCGCACCATCACCCCGTTGATGCAGGAGCAGGCTATTCCGGGTATGGCCGTTGCCGTTATCTACCAGGGAAAACCCTATTAT
TTCACCTGGGGTAAAGCCGATATCGCCAATAACCACCCAGTCACGCAGCAAACGCTGTTTGAGCTAGGATCGGTTAGTAAGACGTTTAAC
GGCGTGTTGGGCGGCGATGCTATCGCCCGCGGCGAAATTAAGCTCAGCGATCCGGTCACGAAATACTGGCCAGAACTGACAGGCAAACAG
TGGCAGGGTATCCGCCTGCTGCACTTAGCCACCTATACGGCAGGCGGCCTACCGCTGCAGATCCCCGATGACGTTAGGGATAAAGCCGCA
TTACTGCATTTTTATCAAAACTGGCAGCCGCAATGGACTCCGGGCGCTAAGCGACTTTACGCTAACTCCAGCATTGGTCTGTTTGGCGCG
CTGGCGGTGAAACCCTCAGGAATGAGTTACGAAGAGGCAATGACCAGACGCGTCCTGCAACCATTAAAACTGGCGCATACCTGGATTACG
GTTCCGCAGAACGAACAAAAAGATTATGCCTGGGGCTATCGCGAAGGGAAGCCCGTACACGTTTCTCCGGGACAACTTGACGCCGAAGCC
TATGGCGTGAAATCCAGCGTTATTGATATGGCCCGCTGGGTTCAGGCCAACATGGATGCCAGCCACGTTCAGGAGAAAACGCTCCAGCAG
GGCATTGCGCTTGCGCAGTCTCGCTACTGGCGTATTGGCGATATGTACCAGGGATTAGGCTGGGAGATGCTGAACTGGCCGCTGAAAGCT
GATTCGATCATCAACGGCAGCGACAGCAAAGTGGCATTGGCAGCGCTTCCCGCCGTTGAGGTAAACCCGCCCGCCCCCGCAGTGAAAGCC
TCATGGGTGCATAAAACGGGCTCCACTGGTGGATTTGGCAGCTACGTAGCCTTCGTTCCAGAAAAAAACCTTGGCATCGTGATGCTGGCA
AACAAAAGCTATCCTAACCCTGTCCGTGTCGAGGCGGCCTGGCGCATTCTTGAAAAGCTGCAATAA

Curator Acknowledgements
Curator Description Most Recent Edit