Acinetobacter baumannii AbuO

Accession ARO:3004578
Synonym(s)Q2FD57 A0A225SC95
DefinitionAbuO is akin to the TolC outer membrane efflux protein. Deletion in A. baumannii results in increased susceptibility to antibiotics including amikacin, carbenicillin, ceftriaxone, meropenem, streptomycin, and tigecycline as well as disinfectants benzyalkonium chloride and chlorhexidine [PMID25512405].
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classtetracycline antibiotic, cephalosporin, aminoglycoside antibiotic, penam, glycylcycline, carbapenem, benzalkonium chloride
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification15 ontology terms | Show
Parent Term(s)10 ontology terms | Show
+ subunit of efflux pump conferring antibiotic resistance
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic carbenicillin [Antibiotic]
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ confers_resistance_to_antibiotic meropenem [Antibiotic]
+ confers_resistance_to_antibiotic streptomycin [Antibiotic]
+ confers_resistance_to_antibiotic tigecycline [Antibiotic]
+ confers_resistance_to_antibiotic benzalkonium chloride [Drug Class]
+ confers_resistance_to_drug_class penam [Drug Class]
+ resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
Publications

Srinivasan VB, et al. 2015. Antimicrob. Agents Chemother. 59(2):1236-45 AbuO, a TolC-like outer membrane protein of Acinetobacter baumannii, is involved in antimicrobial and oxidative stress resistance. (PMID 25512405)

Resistomes

Prevalence of Acinetobacter baumannii AbuO among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 85 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein knockout model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein knockout model

Model Definition: An AMR detection model for instances where the absence of a protein - due to large-scale insertion elements, large deletions, or other methods of protein knockout - confers clinical resistance to a known antibiotic. These models include reference sequences. Protein knockout models are currently in development.

Bit-score Cut-off (blastP): 600


>gb|WP_001985623.1|-|Acinetobacter baumannii AbuO [Acinetobacter baumannii]
MKIKLMLVAGLWSFTSSSFALDLVETYERAKLNDPTWQANQQQFEADQLNLGLATGALLPTVTLSGNITRNRQTVKRSNFPGVDQEGLSD
ALVSNTSTTKQATLSARQPLFRMDAWEGYKQVKTSVALSEITLRLQKQDHVLNVAEAYFNVLRQQALTAAYLQEEKALLEQLNMMNAKLK
EGLVARSDVSEANAQYQNARANRIATNVQLLLAQEQLTEYIGPYQDKLAVLRSDFIFQKPYPAQLDEWLGLAQQQNLKIQQARLQKRYAE
DQRRVEKAALYPQIDAVASYGYTKQTPETLISTDGKFDQVGVEMNWNLFNGGRTRTSIKKASVELNKAQAQLDAAIRRANVDVKSAFMQV
DTDRAKLEARKAAMDSSALVSQASKASYNEGLKSMVDVLLAQRNAFSAKQDYLNAQYDYLLNVLRLKAAVGQLGEKDLVELNSWLTYQ


>gb|NC_010410.1|-|3570601-3571947|Acinetobacter baumannii AbuO [Acinetobacter baumannii]
ATGAAAATAAAATTAATGCTTGTTGCGGGTTTATGGAGTTTTACATCGTCGAGTTTTGCTCTAGATTTAGTTGAAACTTATGAGCGCGCA
AAACTAAATGATCCGACGTGGCAAGCGAATCAACAACAGTTTGAAGCAGATCAGCTTAATTTAGGCTTAGCAACAGGCGCTTTACTACCA
ACAGTTACATTATCTGGAAATATTACCCGTAATCGACAAACGGTAAAGCGTTCAAATTTTCCTGGTGTTGATCAGGAAGGACTTTCCGAT
GCTTTGGTAAGTAATACATCGACTACCAAACAGGCTACTTTATCTGCCCGTCAGCCTCTTTTTCGTATGGATGCATGGGAAGGTTATAAA
CAGGTTAAAACTTCGGTTGCCCTTAGTGAAATTACTTTAAGACTGCAAAAACAAGATCATGTTTTAAATGTAGCTGAAGCCTATTTTAAT
GTACTGCGTCAGCAGGCACTTACCGCTGCATATTTACAAGAAGAAAAAGCCTTGCTTGAACAGCTCAATATGATGAACGCCAAGCTTAAA
GAAGGGTTGGTAGCACGTAGTGATGTGAGTGAAGCAAATGCCCAATATCAAAATGCCCGAGCCAACCGTATTGCTACCAATGTGCAGCTT
TTATTGGCTCAAGAGCAACTAACTGAATATATTGGTCCGTATCAAGATAAGCTTGCTGTATTGAGAAGTGATTTTATCTTTCAAAAACCT
TATCCGGCACAGCTCGATGAGTGGTTAGGATTAGCCCAACAGCAAAATTTAAAGATTCAGCAAGCACGTTTACAAAAGCGATATGCTGAA
GATCAACGTCGTGTGGAAAAAGCTGCACTTTATCCACAGATAGATGCAGTAGCGAGTTATGGTTATACCAAACAAACGCCCGAAACGCTG
ATTTCGACTGATGGGAAGTTTGATCAGGTAGGGGTAGAGATGAACTGGAACTTATTTAATGGAGGCCGGACCCGAACTTCTATTAAAAAA
GCCAGTGTGGAGTTAAATAAAGCGCAAGCCCAACTTGATGCGGCCATTCGCCGTGCCAATGTCGATGTGAAAAGTGCTTTTATGCAGGTA
GATACCGACCGAGCAAAGCTTGAAGCAAGAAAGGCGGCAATGGACTCTTCAGCACTTGTTTCTCAAGCTTCAAAAGCAAGTTATAACGAA
GGCTTAAAAAGTATGGTCGATGTTTTATTGGCGCAGCGTAATGCTTTTTCAGCAAAACAGGATTATCTTAATGCTCAGTATGACTATTTA
TTAAATGTATTACGTTTAAAAGCGGCTGTAGGTCAGCTAGGAGAAAAAGATCTAGTTGAATTAAATAGCTGGTTAACGTATCAGTAA