evgA

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000832
CARD Short NameevgA
DefinitionEvgA, when phosphorylated, is a positive regulator for efflux protein complexes emrKY and mdtEF. While usually phosphorylated in a EvgS dependent manner, it can be phosphorylated in the absence of EvgS when overexpressed.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, major facilitator superfamily (MFS) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classpenicillin beta-lactam, tetracycline antibiotic, fluoroquinolone antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (4)
GAZ
FOODON
ENVO
UBERON
Classification23 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Resistomes with Perfect MatchesEscherichia colig+p+wgs+gi, Shigella boydiig+wgs+gi, Shigella dysenteriaeg+wgs+gi, Shigella flexnerig+wgs+gi, Shigella sonneig+wgs
Resistomes with Sequence VariantsEscherichia colig+p+wgs+gi, Klebsiella pneumoniaewgs, Shigella boydiig+wgs+gi, Shigella dysenteriaeg+wgs+gi, Shigella flexnerig+wgs+gi, Shigella sonneig+wgs+gi
Publications

Hirakawa H, et al. 2003. J. Antimicrob. Chemother. 52(4):576-82 Beta-lactam resistance modulated by the overexpression of response regulators of two-component signal transduction systems in Escherichia coli. (PMID 12951338)

Resistomes

Prevalence of evgA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Escherichia coli67.34%0.12%97.62%67.18%92.38%
Klebsiella pneumoniae0%0%0.01%0%0%
Shigella boydii100%0%92.22%100%0%
Shigella dysenteriae92.86%0%70%25%0%
Shigella flexneri100%0%97.52%40.48%0%
Shigella sonnei100%0%98.61%33.33%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 390


>gb|BAB36671.1|+|evgA [Escherichia coli O157:H7 str. Sakai]
MNAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKNDHFYGKH
CADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNRFVGSLTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKS
RLMEKLECKSLMDLYTFAQRNKIG


>gb|BA000007.3|+|3212026-3212640|evgA [Escherichia coli O157:H7 str. Sakai]
ATGAACGCAATAATTATTGATGACCATCCTCTTGCTATCGCAGCAATTCGTAATTTATTGATCAAAAACGATATTGAAATCTTAGCAGAG
TTGACTGAAGGCGGAAGTGCCGTTCAGCGGGTGGAAACACTTAAGCCTGATATCGTCATCATTGATGTCGATATCCCCGGAGTTAACGGT
ATCCAGGTGTTAGAAACGCTGAGGAAGCGCCAATATAGCGGAATTATTATTATCGTCTCCGCTAAAAATGACCATTTTTACGGGAAACAT
TGTGCTGATGCTGGCGCTAATGGTTTCGTGAGTAAAAAAGAAGGCATGAACAATATCATTGCGGCTATTGAAGCTGCAAAAAATGGCTAC
TGCTATTTCCCCTTCTCTCTCAACCGGTTTGTTGGAAGTTTAACGTCCGACCAGCAAAAACTCGACTCCTTATCGAAACAAGAAATTAGT
GTCATGCGGTATATTCTTGATGGCAAGGATAATAATGACATTGCTGAAAAAATGTTCATCAGCAACAAAACTGTCAGCACTTATAAAAGT
CGCCTGATGGAAAAATTAGAATGTAAATCACTGATGGATCTTTACACATTCGCACAACGTAACAAAATCGGCTAA

Curator Acknowledgements
Curator Description Most Recent Edit