Klebsiella pneumoniae OmpK35

Accession ARO:3003966
CARD Short NameKpne_OmpK35
DefinitionKlebsiella pneumoniae outer membrane porin protein. In beta-lactam-resistant Klebsiella, this porin is often deleted, limiting diffusion of the antibiotic into the cell. Klebsiella strains expressing OmpK35 are often beta-lactam sensitive even in the presence of beta-lactamases because of an inefficient mechanism.
AMR Gene FamilyGeneral Bacterial Porin with reduced permeability to beta-lactams
Drug Classcarbapenem, penem, cephalosporin, cephamycin, penam, monobactam
Resistance Mechanismreduced permeability to antibiotic, resistance by absence
Classification16 ontology terms | Show
Parent Term(s)12 ontology terms | Show
+ gene conferring resistance via absence
+ General Bacterial Porin with reduced permeability to beta-lactams [AMR Gene Family]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ confers_resistance_to_antibiotic benzylpenicillin [Antibiotic]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
+ confers_resistance_to_antibiotic cefoxitin [Antibiotic]
+ confers_resistance_to_antibiotic cefamandole [Antibiotic]
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic cefepime [Antibiotic]
+ confers_resistance_to_antibiotic imipenem [Antibiotic]
+ confers_resistance_to_antibiotic ertapenem [Antibiotic]
Publications

Sugawara E, et al. 2016. J. Bacteriol. : Klebsiella pneumoniae major porins OmpK35 and OmpK36 allow more efficient diffusion of β-lactams than their Escherichia coli homologs OmpF and OmpC. (PMID 27645385)

Resistomes

Prevalence of Klebsiella pneumoniae OmpK35 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein knockout model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
No prevalence data


Detection Models

Model Type: protein knockout model

Model Definition: Protein Knockout Models (PKM) reflect resistance by the absence of a gene product, most often deletion of a gene involved in antibiotic import, such as Vibrio cholerae OmpT. Like Protein Homolog Models (PHMs), PKMs include a reference sequence and a bitscore cut-off for detection using BLASTP but instead are designed to only report lack of detection under Perfect or Strict criteria. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software.

Bit-score Cut-off (blastP): 400


>gb|YP_005226137.1|-|Klebsiella pneumoniae OmpK35 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MGGDGWNYTDNYMTGRTNGVATYRNSDFFGLVDGLSFALQYQGKNDHDRAIRKQNGDGFSTAATYAFDNGIALSAGYSSSNRSVDQKADG
NGDKAEAWATSAKYDANNIYAAVMYSQTYNMTPEEDNHFAGKTQNFEAVVQYQFDFGLRPSIGYVQTKGKDLQSRAGFSGGDADLVKYIE
VGTWYYFNKNMNVYAAYKFNQLDDNDYTKAAGVATDDQAAVGIVYQF


>gb|NC_016845.1|-|1904308-1904991|Klebsiella pneumoniae OmpK35 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
ATGGGCGGTGACGGCTGGAACTATACCGACAACTACATGACCGGTCGTACCAACGGCGTCGCAACCTACCGTAACTCCGACTTCTTCGGT
CTGGTTGACGGTCTGAGCTTCGCGCTGCAGTACCAGGGTAAAAACGACCATGACCGTGCGATTCGCAAGCAGAATGGCGACGGCTTCAGC
ACCGCAGCCACCTACGCGTTCGACAACGGTATCGCACTGTCTGCAGGCTACTCCAGCTCTAACCGTAGCGTCGATCAGAAAGCTGACGGC
AATGGCGACAAAGCCGAAGCCTGGGCGACCTCTGCAAAATATGACGCTAACAACATCTATGCGGCCGTCATGTACTCCCAGACTTACAAC
ATGACTCCGGAAGAAGATAACCACTTCGCTGGTAAAACTCAGAACTTTGAAGCAGTTGTACAGTATCAGTTTGACTTCGGCCTGCGTCCG
TCCATCGGCTACGTACAGACCAAAGGCAAGGACCTGCAGTCGCGTGCTGGCTTCTCCGGCGGCGATGCGGATCTGGTTAAATACATCGAA
GTGGGTACCTGGTACTACTTTAACAAGAACATGAACGTCTACGCTGCGTATAAATTCAACCAGCTGGACGACAACGATTACACCAAAGCG
GCTGGTGTCGCCACTGACGACCAGGCGGCCGTGGGTATCGTTTACCAGTTCTAA