Serratia marcescens Omp1

Accession ARO:3004128
DefinitionOmp1 is an outer membrane porin that confers resistance by absence in S. marcescens. Knockout, deletion or other inhibition of the omp1 gene confers resistance to certain beta-lactamase antibiotics - including Cefoxitin, Ceftriaxone, Cefotaxime, and Moxalactam - as well as Ciprofloxacin, Tetracycline, and Chloramphenicol, by preventing passage of the antibiotic into the cell.
AMR Gene FamilyGeneral Bacterial Porin with reduced permeability to beta-lactams
Drug Classpenam, cephamycin, monobactam, fluoroquinolone antibiotic, tetracycline antibiotic, cephalosporin, phenicol antibiotic, penem, carbapenem
Resistance Mechanismreduced permeability to antibiotic, resistance by absence
Classification20 ontology terms | Show
Parent Term(s)9 ontology terms | Show
+ confers_resistance_to_antibiotic cefoxitin [Antibiotic]
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic cefotaxime [Antibiotic]
+ gene conferring resistance via absence
+ confers_resistance_to_antibiotic moxalactam [Antibiotic]
+ General Bacterial Porin with reduced permeability to beta-lactams [AMR Gene Family]
Publications

Sánchez L, et al. 1997. Microbiologia 13(3):315-20 The role of outer membrane in Serratia marcescens intrinsic resistance to antibiotics. (PMID 9353750)

Li P, et al. 2015. PLoS ONE 10(4):e0123061 Comparative genome analyses of Serratia marcescens FS14 reveals its high antagonistic potential. (PMID 25856195)

Resistomes

Prevalence of Serratia marcescens Omp1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein knockout model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein knockout model

Model Definition: An AMR detection model for instances where the absence of a protein - due to large-scale insertion elements, large deletions, or other methods of protein knockout - confers clinical resistance to a known antibiotic. These models include reference sequences. Protein knockout models are currently in development.

Bit-score Cut-off (blastP): 700


>gb|AIA49384.1|+|Serratia marcescens Omp1 [Serratia sp. FS14]
MKRNILAVVIPALLAAGAANAAEIYNKDGNKLDLYGKVDGLHYFSDDKGNDGDQTYVRFGFKGETQITDQLTGYGQWEYNVQANHSESQG
TEGTKTRLGFAGLKFADYGSFDYGRNYGVLYDVEGWTDMLPEFGGDTYTYTDNFMTGRTNGVATYRNNNFFGLVDGLNFAVQYQGKNQND
GRNVKKQNGDGWGISSTYDIGEGVSFGAAYASSNRTDDQKLRSNERGDKADAWTVGAKYDANNVYLAAMYAETRNMTPFGGGNFGAGCAA
TDDKCGGFASKTQNFEVTAQYQFDFGLRPEVSYLQSKGKNLNVPGVGSDQDLVKYVSVGTTYYFNKNMSTYVDYKINLLDDNEFTKATGT
ATDDIVAVGLVYQF


>gb|CP005927.1|+|4320304-4321494|Serratia marcescens Omp1 [Serratia sp. FS14]
ATGTTTGAAAAAATCACCGCCGCACCCGCCGACCCGATCCTGGGCCTGACCGACATTTTCCGCGCCGACGCCCGCCCGAATAAAATCAAT
TTAGGCATTGGCGTTTATAAAGATGAAACCGGCAAAACCCCGGTGCTGACCAGCGTAAAAAAAGCTGAACAGTATCTGCTGGAAAACGAG
ACCACCAAAAACTATCTCGGCATTGAAGGCATCCCGGCGTTTGCCAGCTGCACGCAAGAGCTGCTGTTCGGTAAAGAGAGCCCGATCGTC
ACCGATCGTCGCGCACGCACCGCACAGACGCCAGGCGGCACCGGCGGCTTGCGCGTAGCGGCAGACTTTATCGCCAACCAGACCAGCGCC
AAGCGCATCTGGATCAGCAACCCAAGCTGGCCGAACCACAAGAACGTCTTTAGCGCCGTTGGCCTGGAAGTGCTGGAGTACGCCTACTAC
GACGCAGCCAACCACGCGCTGGATTTTGACGGCCTGCTGAACAGCCTGAAACAGGCTCAGGCCGGTGATGTCGTGTTGTTCCACGGCTGC
TGCCATAACCCGACCGGTATCGATCCAACGGCGGAACAGTGGGCGCAGCTGGCTGAGCTTTCCGCCGCCAATGGCTGGCTGCCGCTGTTC
GACTTCGCCTACCAGGGCTTCGCCAACGGTCTGGAAGAGGATGCGCAGGGTCTGCGTATTTTCGCCGCCAAACATCAAGAGCTGATCGTC
GCCAGCTCCTACTCGAAAAACTTCGGCCTGTACAATGAGCGCGTCGGCGCTTGCACCCTTGTAGCTGCCGATGCCGAAACCGCCGATCGC
GCCTTCAGCCAGGTGAAGGCGGCCATTCGTGCCAACTACTCTAACCCGCCGTCGCACGGCGCGGCCGTTGTCGCCACCATTCTGGGCAAC
GACGCCCTGCGCGCGATGTGGGAGCAGGAGCTGACCGACATGCGCCAGCGCATTCACCGCATGCGTCAGCTGTTCGTGAACACCCTGCAG
GAGAAAGGCGCACAACAGGACTTCAGCTTTATCATCCAGCAGAACGGCATGTTCTCATTCAGCGGCCTGACCAAAGAACAGGTGCTGCGT
CTGCGTGAAGAGTTCGGCGTATACGCCGTAAACTCGGGCCGGGTGAACGTGGCCGGCATGACGCCGGACAACATGGCACCGCTGTGTGAA
GCCATCGTCGCCGTGCTCTAA