Klebsiella pneumoniae ramR mutants

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003380
CARD Short NameKpne_ramR
DefinitionRamR is a repressor that regulates RamA expression. Mutations lead to the upregulation of AcrAB, which is positively regulated by RamA.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classtetracycline antibiotic, penicillin beta-lactam, cephalosporin, disinfecting agents and antiseptics, phenicol antibiotic, rifamycin antibiotic, glycylcycline, fluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux, antibiotic target alteration
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification32 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic tigecycline [Antibiotic]
+ ramR
Resistomes with Sequence VariantsKlebsiella pneumoniaeg+wgs, Klebsiella quasipneumoniaeg+wgs
Publications

Sheng ZK, et al. 2014. Antimicrob Agents Chemother 58(11): 6982-6985. Mechanisms of tigecycline resistance among Klebsiella pneumoniae clinical isolates. (PMID 25182649)

Resistomes

Prevalence of Klebsiella pneumoniae ramR mutants among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Klebsiella pneumoniae5.5%0%6.69%0%0%
Klebsiella quasipneumoniae0.84%0%0.26%0%0%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 360

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
K5Esingle resistance variantPMID:25182649
A16Dsingle resistance variantPMID:25182649
A19Vsingle resistance variantPMID:25182649
T43Msingle resistance variantPMID:25182649
I88Nsingle resistance variantPMID:25182649
G96Dsingle resistance variantPMID:25182649
T162Isingle resistance variantPMID:25182649

>gb|ABR76005.1|-|Klebsiella pneumoniae ramR mutants [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
MARPKSEDKKQALLEAATAAFAQSGIAASTSAIARSAGVAEGTLFRYFATKDELLNELYL
AIKLRLVRTMIAGLDPDEKRPKENARNIWNSYIDWGVRNPMEHKAIRRMALSERITDETR
RQVKESFPELNEMCQLSVKEIFLSEAYRAFGDALFLSLAETTIEFASHDPQRAREIIALG
FEAMWHALHEADA



>gb|CP000647.1|-|622040-622621|Klebsiella pneumoniae ramR mutants [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
GTGGCTCGTCCAAAGAGTGAAGATAAAAAGCAAGCGTTACTGGAAGCTGCCACCGCGGCTTTCGCCCAGTCCGGCATAGCCGCCTCGACG
TCGGCCATCGCCCGCAGCGCCGGTGTGGCCGAGGGAACGCTGTTTCGCTATTTCGCCACCAAGGATGAGTTGCTCAACGAGCTGTACCTC
GCGATTAAGCTGCGCCTGGTGCGCACAATGATCGCCGGGCTGGATCCGGACGAGAAGCGCCCGAAAGAGAACGCGCGCAATATCTGGAAC
AGCTATATCGACTGGGGCGTGCGCAACCCGATGGAGCACAAAGCGATCCGCCGGATGGCGCTCAGCGAGCGCATCACCGACGAAACCCGC
CGCCAGGTAAAAGAGAGCTTTCCGGAGCTCAACGAAATGTGCCAGCTGTCGGTGAAAGAGATATTCCTCAGCGAGGCGTACCGCGCCTTT
GGCGACGCCCTGTTTCTGTCGCTGGCGGAAACCACCATCGAATTCGCCAGCCACGATCCGCAGCGCGCCCGGGAGATTATCGCCCTCGGC
TTTGAAGCCATGTGGCACGCCCTGCATGAGGCGGACGCCTAA

Curator Acknowledgements
Curator Description Most Recent Edit