lmrP

Accession ARO:3003969
DefinitionlmrP is a proton motive force-dependent drug transporter that is part of the MFS efflux pump family.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, glycylcycline, macrolide antibiotic, isoniazid, phenicol antibiotic, antibacterial free fatty acids, acridine dye, cephalosporin, peptide antibiotic, lincosamide antibiotic, rifamycin antibiotic, penam, oxazolidinone antibiotic, bicyclomycin, fluoroquinolone antibiotic, nucleoside antibiotic, benzalkonium chloride, rhodamine, nitroimidazole antibiotic, diaminopyrimidine antibiotic, fosfomycin, streptogramin antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesStreptococcus pyogenesg+wgs
Classification30 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_drug_class macrolide antibiotic [Drug Class]
+ confers_resistance_to_drug_class lincosamide antibiotic [Drug Class]
+ confers_resistance_to_drug_class streptogramin antibiotic [Drug Class]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_drug_class tetracycline antibiotic [Drug Class]
Publications

van Veen HW, et al. . Antonie Van Leeuwenhoek 76(1-4):347-52 Multidrug resistance in lactic acid bacteria: molecular mechanisms and clinical relevance. (PMID 10532389)

Bolhuis H, et al. 1995. J. Biol. Chem. 270(44):26092-8 The Lactococcal lmrP gene encodes a proton motive force-dependent drug transporter. (PMID 7592810)

Putman M, et al. 2001. Microbiology (Reading, Engl.) 147(Pt 10):2873-80 The lactococcal secondary multidrug transporter LmrP confers resistance to lincosamides, macrolides, streptogramins and tetracyclines. (PMID 11577166)

Resistomes

Prevalence of lmrP among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Streptococcus pyogenes100%0%99.87%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 800


>gb|ABF33001.1|-|lmrP [Streptococcus pyogenes MGAS9429]
MQEFLNLPKQIQLRQLVRFVTITLGSSIFPFMAMYYTTYFGTFWTGLLMMITSLMGFVGTLYGGHLSDALGRKKVIMIGSVGTTLGWFLT
ILANLPNAAIPWLTFAGILLVEIASSFYGPAYEAMLIDLTDESNRRFVYTINYWFINIAVMFGAGLSGLFYDHHFLALLVALLLVNVLCF
GVAYYYFDETRPETHAFDHGKGLLASFQNYRQVFQDRAFVLFTLGAIFSGSIWMQMDNYVPVHLKLYFQPTAVLGFQVTSSKMLSLMVLT
NTLLIVLFMTVVNKLTEKWKLLPQLVVGSLLFTLGMLLAFTFTQFYAIWLSVVLLTFGEMINVPASQVLRADMMDHSQIGSYTGFVSMAQ
PLGAILASLLVSVSHFTGPLGVQCLFVVIALLGIYFTVVSAKMKKV


>gb|CP000259.1|-|1769090-1770310|lmrP [Streptococcus pyogenes MGAS9429]
ATGCAAGAGTTTTTAAACCTTCCTAAGCAGATTCAGCTGAGGCAACTGGTACGCTTTGTGACCATTACCTTAGGCAGTAGTATCTTTCCC
TTTATGGCCATGTATTATACGACTTACTTTGGTACGTTTTGGACAGGCCTCTTAATGATGATTACCAGTTTGATGGGATTTGTTGGAACT
TTATACGGTGGGCATCTGTCAGATGCTCTTGGTCGTAAAAAAGTCATTATGATTGGGTCAGTAGGAACAACGCTAGGCTGGTTTCTGACT
ATTTTAGCTAATTTGCCTAATGCAGCTATTCCTTGGTTAACCTTTGCGGGTATTTTATTGGTAGAGATTGCTTCTAGTTTTTATGGTCCT
GCCTATGAAGCTATGTTGATTGATTTGACTGATGAGAGTAATCGTCGATTTGTTTACACCATCAATTATTGGTTTATCAATATTGCCGTC
ATGTTTGGTGCAGGGCTATCTGGGCTTTTTTATGACCATCATTTTTTAGCCTTGTTAGTAGCCTTATTACTCGTTAATGTACTTTGTTTT
GGCGTTGCTTACTACTATTTTGATGAGACTAGACCAGAAACACACGCTTTTGATCATGGTAAAGGATTACTGGCGAGTTTTCAGAACTAC
CGTCAGGTGTTTCAGGATCGTGCCTTTGTCTTGTTTACCTTAGGTGCCATCTTTTCTGGTAGTATCTGGATGCAGATGGATAACTATGTG
CCAGTCCATTTGAAACTGTATTTTCAGCCAACGGCTGTGTTAGGTTTCCAAGTAACTAGTTCTAAAATGTTATCATTAATGGTTTTAACT
AATACATTGCTGATTGTCCTTTTCATGACAGTAGTAAATAAATTAACGGAAAAATGGAAACTATTACCTCAGCTTGTGGTTGGTTCTTTA
CTATTTACTCTAGGGATGCTCTTGGCATTTACCTTTACGCAGTTCTATGCTATTTGGCTATCAGTTGTTTTGTTAACTTTTGGGGAAATG
ATAAATGTTCCTGCTAGTCAAGTCCTACGTGCTGATATGATGGATCATTCCCAAATAGGATCTTATACAGGTTTTGTGTCAATGGCACAA
CCCCTAGGTGCTATTTTGGCTAGTCTACTAGTATCTGTCAGCCATTTTACAGGTCCTTTAGGTGTGCAATGCTTATTTGTAGTCATTGCT
TTGCTAGGGATTTATTTTACGGTTGTTTCTGCAAAAATGAAAAAGGTGTAG