Escherichia coli acrA

Accession	ARO:3004043
CARD Short Name	Ecol_acrA
Definition	AcrA is a subunit of the AcrAB-TolC multidrug efflux system found in E. coli.
AMR Gene Family	resistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Class	tetracycline antibiotic, penicillin beta-lactam, cephalosporin, disinfecting agents and antiseptics, phenicol antibiotic, rifamycin antibiotic, glycylcycline, fluoroquinolone antibiotic
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Escherichia coli^g+p+wgs, Shigella boydii^g+wgs, Shigella dysenteriae^g+wgs, Shigella flexneri^g+wgs, Shigella sonnei^g+wgs
Resistomes with Sequence Variants	Citrobacter amalonaticus^g+wgs, Citrobacter freundii^g+p+wgs, Citrobacter koseri^g+wgs, Citrobacter portucalensis^g+wgs, Citrobacter werkmanii^g+wgs, Citrobacter youngae^g+wgs, Escherichia albertii^g+wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^g+p+wgs, Escherichia marmotae^g+wgs, Salmonella bongori^g+wgs, Salmonella enterica^g+wgs, Shigella boydii^g+wgs, Shigella dysenteriae^g+wgs, Shigella flexneri^g+wgs, Shigella sonnei^g+wgs
Classification	27 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + beta-lactam antibiotic + mechanism of antibiotic resistance + tetracycline antibiotic [Drug Class] + penicillin beta-lactam [Drug Class] + determinant of antibiotic resistance + antibiotic efflux [Resistance Mechanism] + cephalosporin [Drug Class] + penicillin with extended spectrum + first-generation cephalosporin + disinfecting agents and antiseptics [Drug Class] + phenicol antibiotic [Drug Class] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component] + rifamycin antibiotic [Drug Class] + glycylcycline [Drug Class] + triclosan [Antibiotic] + cefalotin [Antibiotic] + ampicillin [Antibiotic] + chloramphenicol [Antibiotic] + rifampin [Antibiotic] + resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family] + tetracycline [Antibiotic] + tigecycline [Antibiotic] + fluoroquinolone antibiotic [Drug Class] + subunit of efflux pump conferring antibiotic resistance + AcrAB-TolC
Parent Term(s)	1 ontology terms \| Show + acrA
Publications	Du D, et al. 2014. Nature 509(7501):512-5 Structure of the AcrAB-TolC multidrug efflux pump. (PMID 24747401) Nikaido H, et al. 2001. J. Mol. Microbiol. Biotechnol. 3(2):215-8 AcrAB and related multidrug efflux pumps of Escherichia coli. (PMID 11321576) Potrykus J, et al. 2002. Microb. Drug Resist. 8(3):179-85 Inactivation of the acrA gene is partially responsible for chloramphenicol sensitivity of Escherichia coli CM2555 strain expressing the chloramphenicol acetyltransferase gene. (PMID 12363006)

Resistomes

Prevalence of Escherichia coli acrA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter amalonaticus	100%	0%	100%	0%	0%
Citrobacter amalonaticus	0%	0%	0%	0%	0%
Citrobacter freundii	100%	0.31%	98.84%	0%	0%
Citrobacter freundii	0%	0%	0%	0%	0%
Citrobacter koseri	0%	0%	0%	0%	0%
Citrobacter koseri	100%	0%	100%	0%	0%
Citrobacter portucalensis	0%	0%	0%	0%	0%
Citrobacter portucalensis	100%	0%	100%	0%	0%
Citrobacter werkmanii	0%	0%	0%	0%	0%
Citrobacter werkmanii	100%	0%	100%	0%	0%
Citrobacter youngae	0%	0%	0%	0%	0%
Citrobacter youngae	100%	0%	100%	0%	0%
Escherichia albertii	0%	0%	0%	0%	0%
Escherichia albertii	100%	0%	100%	0%	0%
Escherichia coli	67.84%	0.01%	99.15%	0%	99.82%
Escherichia coli	46.28%	0.01%	64.93%	0%	49.34%
Escherichia fergusonii	0%	0%	0%	0%	0%
Escherichia fergusonii	100%	0.36%	98.91%	0%	0%
Escherichia marmotae	100%	0%	97.92%	0%	0%
Escherichia marmotae	0%	0%	0%	0%	0%
Salmonella bongori	91.67%	0%	100%	0%	0%
Salmonella bongori	0%	0%	0%	0%	0%
Salmonella enterica	95.71%	0%	99.42%	0%	0%
Salmonella enterica	0%	0%	0%	0%	0%
Shigella boydii	20%	0%	18.89%	0%	0%
Shigella boydii	100%	0%	100%	0%	0%
Shigella dysenteriae	14.29%	0%	10%	0%	0%
Shigella dysenteriae	100%	0%	100%	0%	0%
Shigella flexneri	32%	0%	1.09%	0%	0%
Shigella flexneri	100%	0%	99.84%	0%	0%
Shigella sonnei	100%	0%	100%	0%	0%
Shigella sonnei	2.44%	0%	3.73%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 670

Protein
DNA

>gb|AAC73565.1|-|Escherichia coli acrA [Escherichia coli str. K-12 substr. MG1655]
MNKNRGFTPLAVVLMLSGSLALTGCDDKQAQQGGQQMPAVGVVTVKTEPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAG
VSLYQIDPATYQATYDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPI
SGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDFLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQT
TGSITLRAIFPNPDHTLLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVASQAIGDKWLVTEGLKAGDRVV
ISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS

>gb|U00096.3|-|484426-485619|Escherichia coli acrA [Escherichia coli str. K-12 substr. MG1655]
ATGAACAAAAACAGAGGGTTTACGCCTCTGGCGGTCGTTCTGATGCTCTCAGGCAGCTTAGCCCTAACAGGATGTGACGACAAACAGGCC
CAACAAGGTGGCCAGCAGATGCCCGCCGTTGGCGTAGTAACAGTCAAAACTGAACCTCTGCAGATCACAACCGAGCTTCCGGGTCGCACC
AGTGCCTACCGGATCGCAGAAGTTCGTCCTCAAGTTAGCGGGATTATCCTGAAGCGTAATTTCAAAGAAGGTAGCGACATCGAAGCAGGT
GTCTCTCTCTATCAGATTGATCCTGCGACCTATCAGGCGACATACGACAGTGCGAAAGGTGATCTGGCGAAAGCCCAGGCTGCAGCCAAT
ATCGCGCAATTGACGGTGAATCGTTATCAGAAACTGCTCGGTACTCAGTACATCAGTAAGCAAGAGTACGATCAGGCTCTGGCTGATGCG
CAACAGGCGAATGCTGCGGTAACTGCGGCGAAAGCTGCCGTTGAAACTGCGCGGATCAATCTGGCTTACACCAAAGTCACCTCTCCGATT
AGCGGTCGCATTGGTAAGTCGAACGTGACGGAAGGCGCATTGGTACAGAACGGTCAGGCGACTGCGCTGGCAACCGTGCAGCAACTTGAT
CCGATCTACGTTGATGTGACCCAGTCCAGCAACGACTTCCTGCGCCTGAAACAGGAACTGGCGAATGGCACGCTGAAACAAGAGAACGGC
AAAGCCAAAGTGTCACTGATCACCAGTGACGGCATTAAGTTCCCGCAGGACGGTACGCTGGAATTCTCTGACGTTACCGTTGATCAGACC
ACTGGGTCTATCACCCTACGCGCTATCTTCCCGAACCCGGATCACACTCTGCTGCCGGGTATGTTCGTGCGCGCACGTCTGGAAGAAGGG
CTTAATCCAAACGCTATTTTAGTCCCGCAACAGGGCGTAACCCGTACGCCGCGTGGCGATGCCACCGTACTGGTAGTTGGCGCGGATGAC
AAAGTGGAAACCCGTCCGATCGTTGCAAGCCAGGCTATTGGCGATAAGTGGCTGGTGACAGAAGGTCTGAAAGCAGGCGATCGCGTAGTA
ATAAGTGGGCTGCAGAAAGTGCGTCCTGGTGTCCAGGTAAAAGCACAAGAAGTTACCGCTGATAATAACCAGCAAGCCGCAAGCGGTGCT
CAGCCTGAACAGTCCAAGTCTTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

Escherichia coli acrA

Prevalence: protein homolog model (view sequences)

Graph