adeN

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000559
CARD Short NameadeN
DefinitionAdeN is a repressor of AdeIJK, a RND-type efflux pump in Acinetobacter baumannii. Its inactivation increases expression of AdeJ.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classpenicillin beta-lactam, phenicol antibiotic, diaminopyrimidine antibiotic, rifamycin antibiotic, tetracycline antibiotic, carbapenem, cephalosporin, lincosamide antibiotic, fluoroquinolone antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Klebsiella pneumoniaewgs
Classification25 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Rosenfeld N, et al. 2012. Antimicrob Agents Chemother 56(5): 2504-2510. Expression of the resistance-nodulation-cell division pump AdeIJK in Acinetobacter baumannii is regulated by AdeN, a TetR-type regulator. (PMID 22371895)

Resistomes

Prevalence of adeN among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii71.86%0.1%69.41%0%0%
Klebsiella pneumoniae0%0%0.01%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 420


>gb|AGV28567.1|+|adeN [Acinetobacter baumannii]
MHDPVLESHHLVCEKPQTRRGIERRLALLLSATELFLEKGYDAVSLDDIVNHAGGSKTSIYKYFGNKDGLFTAICDYRREMFFKDICIAF
QPEQTSLKDYLIQTLIRFYKPFIQPEHIAFLRLVIEQTQCNATLSQYLYEKCALDVQNTIAQALLISHQSGEITCTSPDHSSLMYFGILR
DIEWRMIMGMPLPPNETEVIDYINYCVDIFLKGHHKV


>gb|KF147862.1|+|1-654|adeN [Acinetobacter baumannii]
ATGCATGATCCAGTCCTTGAGTCACATCATCTCGTATGTGAAAAACCCCAAACACGCCGCGGTATAGAACGTCGTTTAGCTCTATTGCTA
AGCGCAACCGAGCTGTTTTTGGAAAAAGGATATGATGCTGTCTCTCTTGACGACATCGTTAATCATGCTGGTGGTTCAAAAACCTCTATT
TATAAATACTTCGGTAATAAAGATGGCTTATTTACTGCAATCTGCGATTATCGCCGTGAAATGTTTTTTAAAGATATCTGCATTGCATTT
CAACCAGAGCAAACTTCTTTAAAAGATTATTTAATCCAAACTCTCATCCGTTTTTATAAGCCCTTTATTCAACCTGAACACATTGCCTTT
TTACGTTTGGTTATTGAACAAACTCAATGTAATGCAACTTTGAGCCAATACTTATATGAAAAATGTGCTCTGGATGTCCAAAATACAATT
GCTCAAGCCTTACTCATATCTCATCAATCAGGTGAAATTACCTGTACATCTCCTGATCATTCCTCTCTTATGTATTTTGGAATTTTACGT
GATATTGAATGGCGAATGATTATGGGAATGCCTCTCCCACCCAATGAGACAGAAGTTATTGATTATATTAATTATTGTGTTGATATTTTC
TTAAAGGGGCATCATAAAGTCTAA

Curator Acknowledgements
Curator Description Most Recent Edit