H-NS

Accession ARO:3000676
Synonym(s)hns
CARD Short NameH-NS
DefinitionH-NS is a histone-like protein involved in global gene regulation in Gram-negative bacteria. It is a repressor of the membrane fusion protein genes acrE, mdtE, and emrK as well as nearby genes of many RND-type multidrug exporters.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, major facilitator superfamily (MFS) antibiotic efflux pump
Drug Classtetracycline antibiotic, penam, cephamycin, cephalosporin, fluoroquinolone antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Resistomes with Perfect MatchesEscherichia colig+p+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs
Resistomes with Sequence VariantsCitrobacter amalonaticusg+wgs, Citrobacter freundiig+wgs, Citrobacter koserig+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniig+wgs, Citrobacter youngaeg+wgs, Cronobacter condimentig+wgs, Cronobacter dublinensisg+wgs, Cronobacter malonaticusg+wgs, Cronobacter sakazakiig+wgs, Cronobacter turicensiswgs, Cronobacter universalisg+wgs, Enterobacter asburiaeg+wgs, Enterobacter cancerogenusg+wgs, Enterobacter chengduensisg+wgs, Enterobacter cloacaeg+wgs, Enterobacter hormaecheig+wgs, Enterobacter kobeig+wgs, Enterobacter roggenkampiig+wgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+wgs, Escherichia marmotaeg+wgs, Klebsiella aerogenesg+wgs+gi, Klebsiella huaxiensisg+wgs, Klebsiella michiganensisg+wgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaeg+wgs, Kosakonia arachidisg+wgs, Leclercia adecarboxylatag+wgs, Raoultella planticolag+wgs, Salmonella bongorig+wgs, Salmonella entericag+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs
Classification23 ontology terms | Show
Parent Term(s)5 ontology terms | Show
Publications

Nishino K and Yamaguchi A. 2004. J Bacteriol 186(5): 1423-1429. Role of histone-like protein H-NS in multidrug resistance of Escherichia coli. (PMID 14973023)

Resistomes

Prevalence of H-NS among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Citrobacter amalonaticus100%0%89.09%0%
Citrobacter freundii100%0%50.68%0%
Citrobacter koseri100%0%49.55%0%
Citrobacter portucalensis100%0%61.26%0%
Citrobacter werkmanii100%0%61.54%0%
Citrobacter youngae100%0%100%0%
Cronobacter condimenti100%0%100%0%
Cronobacter dublinensis100%0%100%0%
Cronobacter malonaticus100%0%83.64%0%
Cronobacter sakazakii100%0%91.48%0%
Cronobacter turicensis0%0%83.33%0%
Cronobacter universalis100%0%100%0%
Enterobacter asburiae100%0%70.75%0%
Enterobacter cancerogenus100%0%100%0%
Enterobacter chengduensis100%0%84%0%
Enterobacter cloacae100%0%72.84%0%
Enterobacter hormaechei99.64%0%66.98%0%
Enterobacter kobei100%0%67.69%0%
Enterobacter roggenkampii100%0%61.87%0%
Escherichia albertii100%0%62.58%0%
Escherichia coli67.77%0.1%61.66%0%
Escherichia fergusonii100%0%48.91%0%
Escherichia marmotae100%0%70.83%0%
Klebsiella aerogenes100%0%79.94%25%
Klebsiella huaxiensis100%0%66.67%0%
Klebsiella michiganensis100%0%69.41%0%
Klebsiella oxytoca100%0%75.21%0%
Klebsiella pneumoniae99.35%0.07%57.29%0%
Klebsiella quasipneumoniae100%0%73.68%0%
Kosakonia arachidis100%0%100%0%
Leclercia adecarboxylata100%0%60.47%0%
Raoultella planticola100%0%94.87%0%
Salmonella bongori100%0%94.74%0%
Salmonella enterica95.77%0%81.01%0%
Shigella boydii93.33%0%98.89%0%
Shigella dysenteriae100%0%93.33%0%
Shigella flexneri100%0%81.99%0%
Shigella sonnei100%0%95.76%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 240


>gb|BAB35162.1|-|H-NS [Escherichia coli O157:H7 str. Sakai]
MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKR
AQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ


>gb|BA000007.3|-|1737691-1738104|H-NS [Escherichia coli O157:H7 str. Sakai]
ATGAGCGAAGCACTTAAAATTCTGAACAACATCCGTACTCTTCGTGCGCAGGCAAGAGAATGTACACTTGAAACGCTGGAAGAAATGCTG
GAAAAATTAGAAGTTGTTGTTAACGAACGTCGCGAAGAAGAAAGCGCGGCTGCTGCTGAAGTTGAAGAGCGCACTCGTAAACTGCAGCAA
TATCGCGAAATGCTGATCGCTGACGGTATTGACCCGAACGAGCTGCTGAATAGCCTTGCCGCCGTTAAATCTGGCACCAAAGCTAAACGT
GCTCAGCGTCCGGCAAAATATAGCTACGTTGACGAAAACGGCGAAACTAAAACCTGGACTGGCCAGGGCCGTACTCCAGCTGTAATCAAA
AAAGCAATGGATGAGCAAGGTAAATCCCTCGACGATTTCCTGATCAAGCAATAA