adeJ

Accession ARO:3000781
DefinitionAdeJ is a RND efflux protein that acts as the inner membrane transporter of the AdeIJK efflux complex. It has 57% identity with E. coli AcrB.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classtetracycline antibiotic, penam, carbapenem, diaminopyrimidine antibiotic, macrolide antibiotic, phenicol antibiotic, acridine dye, glycylcycline, fluoroquinolone antibiotic, monobactam, rifamycin antibiotic, triclosan, aminoglycoside antibiotic, antibacterial free fatty acids, penem, aminocoumarin antibiotic, cephalosporin, lincosamide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification34 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Damier-Piolle L, et al. 2008. Antimicrob Agents Chemother 52(2): 557-562. AdeIJK, a resistance-nodulation-cell division pump effluxing multiple antibiotics in Acinetobacter baumannii. (PMID 18086852)

Resistomes

Prevalence of adeJ among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii98.73%0.29%99.72%
Acinetobacter nosocomialis100%0%100%
Escherichia coli0%0%0%
Helicobacter pylori0%0%0.09%
Klebsiella oxytoca0%0%0%
Klebsiella pneumoniae0%0%0%
Proteus mirabilis0%0%0.86%
Staphylococcus aureus0%0%0.03%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 2100


>gb|AAX14802.1|+|adeJ [Acinetobacter baumannii]
MAQFFIHRPIFAWVIALVIMLAGILTLTKMPIAQYPTIAPPTVTIAATYPGASAETVENTVTQIIEQQMNGLDGLRYISSNSAGNGQASI
QLNFEQGVDPDIAQVQVQNKLQSATALLPEDVQRQGVTVTKSGASFLQVIAFYSPDNNLSDSDIKDYVNSSIKEPLSRVAGVGEVQVFGG
SYAMRIWLDPAKLTSYQLTPSDIATALQAQNSQVAVGQLGGAPAVQGQVLNATVNAQSLLQTPEQFKNIFLKNTASGAEVRLKDVARVEL
GSDNYQFDSKFNGKPAAGLAIKIATGANALDTAEAVEQRLSELRKNYPTGLADKLAYDTTPFIRLSIESVVHTLIEAVILVFIVMFLFLQ
NWRATIIPTLAVPVVVLGTFAVINIFGFSINTLTMFAMVLAIGLLVDDAIVVVENVERVMSEDHTDPVTATSRSMQQISGALVGITSVLT
AVFVPMAFFGGTTGVIYRQFSITLVTAMVLSLIVALTFTPALCATILKQHDPNKEPSNNIFARFFRSFNNGFDRMSHSYQNGVSRMLKGK
IFSGVLYAVVVALLVFLFQKLPSSFLPEEDQGVVMTLVQLPPNATLDRTGKVIDTMTNFFMNEKDTVESIFTVSGFSFTGVGQNAGIGFV
KLKDWSKRTTPETQIGSLIQRGMALNMIIKDASYVMPLQLPAMPELGVTAGFNLQLKDSSGQGHEKLIAARNTILGLASQDKRLVGVRPN
GQEDTPQYQINVDQAQAGAMGVSIAEINNTMRIAWGGSYINDFVDRGRVKKVYVQGDAGSRMMPEDLNKWYVRNNKGEMVPFSAFATGEW
TYGSPRLERYNGVSSVNIQGTPAPGVSSGDAMKAMEEIIGKLPSMGLQGFDYEWTGLSLEERESGAQAPFLYALSLLIVFLCLAALYESW
SIPFSVLLVVPLGVIGAIVLTYLGMIIKGDPNLSNNIYFQVAIIAVIGLSAKNAILIVEFAKELQEKGEDLLDATLHAAKMRLRPIIMTT
LAFGFGVLPLALSTGAGAGSQHSVGFGVLGGVLSATFLGIFFIPVFYVWIRSMFKYKPKTINTQEHKS


>gb|AY769962|+|2435-5611|adeJ [Acinetobacter baumannii]
ATGGCACAATTTTTTATTCATCGCCCCATATTTGCGTGGGTGATTGCATTAGTCATTATGTTGGCGGGTATTCTTACGCTAACAAAAATG
CCTATTGCACAATATCCAACGATTGCACCACCAACCGTAACGATTGCTGCGACTTATCCTGGTGCATCGGCTGAAACAGTTGAAAATACT
GTAACCCAGATCATTGAACAACAAATGAATGGTCTTGATGGCTTACGTTATATTTCATCTAACAGTGCTGGTAATGGTCAGGCATCTATT
CAATTAAACTTTGAACAAGGTGTTGACCCTGATATTGCACAGGTTCAAGTTCAAAACAAATTGCAATCTGCAACTGCGCTTTTACCTGAA
GATGTACAACGTCAAGGTGTAACAGTTACTAAATCTGGTGCGAGCTTCTTGCAAGTTATTGCATTCTATTCACCAGATAACAACCTGTCA
GACTCTGACATTAAAGACTACGTAAACTCGTCAATTAAAGAACCGCTTAGCCGTGTTGCCGGTGTTGGTGAGGTACAGGTCTTCGGTGGC
TCATACGCAATGCGTATCTGGCTTGATCCAGCTAAATTAACAAGCTATCAACTTACTCCTAGTGATATTGCAACTGCCTTACAAGCGCAG
AACTCGCAAGTTGCCGTAGGTCAGTTAGGTGGTGCTCCGGCTGTACAAGGTCAAGTTCTTAACGCAACAGTAAATGCACAAAGCTTATTG
CAGACTCCTGAACAGTTTAAAAATATCTTCTTAAAGAACACAGCATCAGGTGCTGAGGTTCGATTAAAAGATGTTGCTCGCGTAGAATTA
GGTTCGGATAACTATCAATTCGACTCGAAGTTTAACGGTAAACCGGCAGCTGGTCTTGCAATTAAAATTGCAACAGGTGCTAACGCACTC
GACACAGCCGAAGCAGTTGAACAACGTTTATCTGAACTACGTAAGAACTATCCAACAGGTCTTGCAGATAAACTGGCTTATGACACGACT
CCATTTATCCGTCTTTCAATTGAAAGTGTAGTACACACATTAATTGAAGCCGTGATTTTGGTATTCATTGTCATGTTCCTATTCTTACAA
AACTGGCGTGCAACGATTATTCCAACGCTTGCAGTTCCAGTAGTTGTATTAGGTACATTTGCGGTCATTAATATCTTTGGCTTCTCAATT
AACACCTTAACCATGTTCGCTATGGTATTGGCAATCGGTCTTCTGGTCGACGACGCCATTGTTGTAGTCGAAAACGTTGAACGTGTGATG
AGTGAAGACCATACCGATCCGGTTACGGCCACTTCTCGCTCAATGCAGCAGATTTCTGGTGCGTTAGTAGGTATTACCAGCGTATTGACA
GCGGTATTCGTACCAATGGCTTTCTTTGGTGGTACAACAGGTGTAATTTACCGCCAGTTCTCGATTACCCTTGTAACTGCAATGGTTCTG
TCGTTAATTGTAGCGTTGACGTTCACACCGGCACTTTGTGCAACTATCTTGAAACAGCATGATCCTAATAAAGAACCAAGCAATAATATC
TTTGCGCGTTTCTTTAGAAGCTTTAACAATGGTTTTGACCGCATGTCGCATAGCTACCAAAATGGTGTTAGCCGCATGCTTAAAGGCAAA
ATCTTCTCTGGCGTGCTCTATGCTGTTGTAGTTGCCCTTTTAGTCTTCTTGTTCCAAAAACTCCCGTCTTCATTCTTACCAGAAGAAGAT
CAGGGTGTGGTCATGACACTTGTACAATTACCACCAAATGCAACGCTTGACCGTACCGGTAAAGTGATTGATACCATGACTAACTTCTTT
ATGAATGAAAAAGATACCGTGGAATCTATTTTCACTGTTTCTGGTTTCTCATTCACAGGTGTTGGTCAAAACGCGGGTATTGGCTTCGTT
AAGTTGAAAGACTGGAGCAAACGTACGACACCAGAAACTCAAATTGGTTCATTGATTCAGCGTGGTATGGCATTAAATATGATCATTAAA
GATGCATCATACGTTATGCCGTTACAGCTTCCAGCAATGCCTGAACTTGGTGTAACTGCCGGATTTAACTTGCAGCTTAAAGATTCAAGT
GGTCAAGGCCATGAGAAACTGATTGCAGCTCGTAACACGATTTTAGGTTTGGCATCACAAGATAAACGTCTTGTAGGTGTGCGTCCAAAT
GGTCAGGAAGATACTCCTCAGTATCAAATTAATGTAGATCAGGCTCAAGCTGGTGCTATGGGCGTTAGTATTGCCGAAATCAACAATACA
ATGCGTATTGCATGGGGTGGCTCATACATTAACGATTTCGTTGACCGTGGTCGTGTGAAAAAAGTTTATGTTCAAGGTGATGCGGGCAGC
CGTATGATGCCTGAAGACTTAAACAAATGGTATGTACGTAATAACAAAGGTGAGATGGTTCCATTCTCGGCATTTGCTACAGGCGAATGG
ACGTATGGTTCTCCACGTCTCGAACGTTATAACGGCGTGTCATCGGTTAACATTCAAGGTACACCTGCACCTGGCGTGAGCTCTGGTGAT
GCCATGAAAGCAATGGAAGAAATTATTGGTAAGTTACCATCTATGGGCTTACAAGGTTTCGACTATGAGTGGACAGGCTTATCACTTGAA
GAACGTGAGTCTGGTGCTCAAGCGCCGTTCTTATACGCACTTTCATTGTTAATCGTATTCCTTTGCTTGGCTGCACTATATGAAAGCTGG
TCAATTCCGTTCTCGGTTTTACTTGTGGTACCACTTGGTGTCATTGGTGCAATCGTATTGACCTACTTGGGCATGATTATTAAAGGAGAT
CCAAATCTCTCAAATAACATTTACTTCCAGGTAGCGATTATTGCGGTTATCGGTCTTTCTGCAAAAAATGCGATCTTGATTGTTGAATTC
GCAAAAGAATTGCAGGAAAAAGGTGAAGATCTACTTGATGCAACCTTACATGCTGCAAAAATGCGTTTACGTCCAATTATCATGACCACC
CTTGCCTTCGGTTTCGGTGTACTTCCACTTGCACTTTCAACAGGTGCCGGTGCAGGAAGTCAGCACTCTGTAGGCTTTGGTGTACTTGGT
GGCGTACTCAGCGCGACGTTCTTAGGAATCTTCTTTATCCCTGTATTCTATGTGTGGATTCGTAGTATGTTTAAGTACAAACCAAAAACC
ATAAACACTCAGGAGCATAAATCGTGA