adeK

Accession ARO:3000782
DefinitionAdeK is the outer membrane factor protein in the adeIJK multidrug efflux complex.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classrifamycin antibiotic, penem, phenicol antibiotic, tetracycline antibiotic, diaminopyrimidine antibiotic, carbapenem, macrolide antibiotic, lincosamide antibiotic, fluoroquinolone antibiotic, cephalosporin
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesAcinetobacter baumanniig+p+wgs
Classification25 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Damier-Piolle L, et al. 2008. Antimicrob Agents Chemother 52(2): 557-562. AdeIJK, a resistance-nodulation-cell division pump effluxing multiple antibiotics in Acinetobacter baumannii. (PMID 18086852)

Resistomes

Prevalence of adeK among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii98.73%0.29%99.72%
Acinetobacter nosocomialis100%0%100%
Enterobacter hormaechei0%0%0.16%
Klebsiella pneumoniae0%0%0%
Proteus mirabilis0%0%0%
Staphylococcus aureus0%0%0.03%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 950


>gb|AAX14803.1|+|adeK [Acinetobacter baumannii]
MQKVWSISGRSIAVSALALALAACQSMRGPEPVVKTDIPQSYAYNSASGTSIAEQGYKQFFADPRLLEVIDLALANNRDLRTATLNIERA
QQQYQITQNNQLPTIGASGSAIRQVSQSRDPNNPYSTYQVGLGVTAYELDFWGRVRSLKDAALDSYLATQSARDSTQISLISQVAQAWLN
YSFATANLRLAEQTLKAQLDSYNLNKKRFDVGIDSEVPLRQAQISVETARNDVANYKTQIAQAQNLLNLLVGQPVPQNLLPTQPVKRIAQ
QNVFTAGLPSDLLNNRPDVKAAEYNLSAAGANIGAAKARLFPTISLTGSAGYASTDLSDLFKSGGFVWSVGPSLDLPIFDWGTRRANVKI
SETDQKIALSDYEKSVQSAFREVNDALATRANIGERLTAQQRLVEATNRNYTLSNARFRAGIDSYLTVLDAQRSSYAAEQGLLLLQQANL
NNQIELYKTLGGGLKANTSDTVVHQPSSAELKKQ


>gb|AY769962|+|5611-7065|adeK [Acinetobacter baumannii]
ATGCAAAAAGTATGGTCTATTTCAGGTCGTAGCATTGCGGTGTCTGCACTTGCGCTTGCTTTGGCAGCTTGTCAAAGCATGCGCGGCCCA
GAACCAGTCGTGAAAACCGATATACCACAAAGCTATGCATATAACAGCGCTTCTGGTACGTCTATTGCTGAACAGGGTTATAAACAGTTC
TTTGCTGACCCGCGTTTGCTTGAAGTGATTGATTTGGCTCTTGCCAATAACCGTGACTTACGTACAGCAACGCTCAATATTGAACGTGCT
CAACAGCAATATCAGATTACACAGAACAACCAGCTTCCAACAATCGGAGCAAGTGGTAGTGCAATTCGTCAGGTTTCTCAAAGCCGTGAT
CCGAATAACCCCTACTCTACTTATCAAGTAGGTTTGGGTGTAACTGCTTATGAGCTAGATTTCTGGGGTCGTGTTCGTAGCCTCAAAGAT
GCTGCTTTAGATAGTTATCTTGCAACACAAAGTGCTCGTGATTCGACTCAAATCAGTCTGATTAGCCAAGTTGCTCAAGCATGGTTAAAT
TATTCGTTTGCAACAGCAAACTTAAGACTGGCAGAGCAAACGCTTAAAGCACAGTTAGATTCTTACAATCTCAACAAAAAACGTTTTGAT
GTAGGTATTGACAGTGAAGTTCCATTACGTCAAGCACAGATTTCTGTAGAAACTGCGCGTAATGATGTAGCGAACTACAAAACTCAAATT
GCTCAAGCACAAAACTTGTTGAACTTGCTTGTAGGCCAACCTGTTCCACAAAACTTGTTACCTACACAACCTGTAAAACGCATTGCTCAA
CAAAATGTGTTTACTGCCGGTTTACCAAGTGACTTGTTAAATAACCGTCCGGATGTAAAAGCTGCTGAATACAACTTAAGCGCTGCGGGT
GCGAATATCGGTGCTGCAAAAGCACGTTTATTCCCAACCATTAGCTTAACGGGTTCGGCTGGTTATGCATCAACTGACTTAAGTGATCTA
TTTAAGTCTGGTGGTTTTGTATGGTCAGTTGGTCCAAGCTTAGATTTACCAATCTTTGACTGGGGTACACGCCGTGCCAATGTAAAAATT
TCTGAAACCGATCAGAAAATTGCATTGTCTGATTATGAAAAATCAGTTCAGTCGGCGTTCCGTGAAGTTAATGACGCGCTTGCAACTCGT
GCCAATATTGGTGAGCGTTTAACAGCACAACAACGTCTAGTAGAAGCAACTAACCGCAACTACACACTTTCAAATGCCCGCTTCCGTGCC
GGTATTGATAGTTACTTGACTGTTCTTGATGCACAGCGTTCTTCATATGCAGCTGAACAAGGTTTGTTATTGCTTCAACAAGCAAACTTA
AACAACCAAATCGAGTTATACAAAACTCTAGGTGGTGGTTTAAAAGCAAATACTTCAGATACAGTGGTTCACCAACCATCTAGTGCTGAA
CTTAAAAAGCAATAA