Salmonella enterica ramR mutants

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003379
CARD Short NameSent_ramR
DefinitionRamR is a repressor that regulates RamA expression. Mutations lead to the upregulation of AcrAB, which is positively regulated by RamA.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classtetracycline antibiotic, penicillin beta-lactam, cephalosporin, disinfecting agents and antiseptics, phenicol antibiotic, rifamycin antibiotic, glycylcycline, fluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux, antibiotic target alteration
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification32 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ ramR
Resistomes with Sequence VariantsSalmonella entericawgs
Publications

Kehrenberg C, et al. 2009. J Antimicrob Chemother 64(6): 1175-1180. Decreased fluoroquinolone susceptibility in mutants of Salmonella serovars other than Typhimurium: detection of novel mutations involved in modulated expression of ramA and soxS. (PMID 19778917)

Abouzeed YM, et al. 2008. Antimicrob Agents Chemother 52(7): 2428-2434. ramR mutations involved in efflux-mediated multidrug resistance in Salmonella enterica serovar Typhimurium. (PMID 18443112)

O'Regan E, et al. 2009. Antimicrob Agents Chemother 53(3): 1080-1087. Multiple regulatory pathways associated with high-level ciprofloxacin and multidrug resistance in Salmonella enterica serovar enteritidis: involvement of RamA and other global regulators. (PMID 19104017)

Ricci V and Piddock LJ. 2009. J Antimicrob Chemother 63(5): 909-916. Ciprofloxacin selects for multidrug resistance in Salmonella enterica serovar Typhimurium mediated by at least two different pathways. (PMID 19270312)

Resistomes

Prevalence of Salmonella enterica ramR mutants among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Salmonella enterica0%0%0.11%0%0%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 370

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
T18Psingle resistance variantPMID:18443112
G25Asingle resistance variantPMID:19104017
R46Psingle resistance variantPMID:19778917
T50Psingle resistance variantPMID:19270312
Y59Hsingle resistance variantPMID:18443112
M84Isingle resistance variantPMID:18443112
E160Dsingle resistance variantPMID:19778917

>gb|ACH50230.1|-|Salmonella enterica ramR mutants [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MARPKSEDKKQALLEAATQAIAQSGIAASTAVIARNAGVAEGTLFRYFATKDELINTLYL
HLKQDLCQSMIMELDRSITDAKMMTRFIWNSYISWGLNHPARHRAIRQLAVSEKLTKETE
QRADDMFPELRDLCHRSVLMVFMSDEYRAFGDGLFLALAETTMDFAARDPARAGEYIALG
FEAMWRALTREEQ



>gb|CP001138.1|-|613436-614017|Salmonella enterica ramR mutants [Salmonella enterica subsp. enterica serovar Agona str. SL483]
GTGGCTCGTCCGAAGAGTGAAGACAAAAAACAAGCATTACTGGAAGCGGCAACCCAGGCGATAGCGCAATCCGGTATCGCCGCCTCAACG
GCGGTGATTGCGCGTAACGCAGGTGTTGCAGAAGGAACATTGTTTCGCTATTTCGCGACCAAAGATGAGCTGATTAACACGTTGTATTTG
CATTTAAAGCAGGATCTCTGCCAGTCAATGATAATGGAGCTGGATCGATCCATTACCGATGCCAAAATGATGACCCGTTTTATCTGGAAC
AGTTACATCAGTTGGGGTCTGAACCATCCCGCGCGCCATCGGGCGATCCGTCAACTGGCCGTCAGCGAAAAGCTCACCAAAGAGACGGAA
CAACGGGCCGACGATATGTTCCCCGAATTGCGCGATTTATGTCATCGTTCCGTTTTGATGGTGTTTATGTCGGATGAGTACCGCGCCTTC
GGCGACGGCCTTTTTCTGGCGCTGGCTGAAACAACAATGGATTTCGCCGCGCGCGATCCCGCTCGCGCTGGCGAATATATTGCGCTGGGA
TTCGAAGCCATGTGGCGCGCGCTGACTCGCGAGGAGCAATAA

Curator Acknowledgements
Curator Description Most Recent Edit