AcrS

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000656
Synonym(s)ECK3251 envR JW3232 yhdK
CARD Short NameAcrS
DefinitionAcrS is a repressor of the AcrAB efflux complex and is associated with the expression of AcrEF. AcrS is believed to regulate a switch between AcrAB and AcrEF efflux.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classtetracycline antibiotic, penicillin beta-lactam, cephalosporin, disinfecting agents and antiseptics, phenicol antibiotic, rifamycin antibiotic, glycylcycline, fluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification28 ontology terms | Show
Parent Term(s)4 ontology terms | Show
Resistomes with Perfect MatchesEscherichia colig+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneiwgs
Resistomes with Sequence VariantsEscherichia colig+p+wgs, Escherichia marmotaeg+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs
Publications

Hirakawa H, et al. 2008. J Bacteriol 190(18): 6276-6279. AcrS/EnvR represses expression of the acrAB multidrug efflux genes in Escherichia coli. (PMID 18567659)

Resistomes

Prevalence of AcrS among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Escherichia coli64.27%0.04%94.92%0%94.1%
Escherichia marmotae100%0%97.92%0%0%
Shigella boydii93.33%0%86.67%0%0%
Shigella dysenteriae14.29%0%70%0%0%
Shigella flexneri29%0%4.66%0%0%
Shigella sonnei100%0%98.54%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 380


>gb|AAC76296.1|-|AcrS [Escherichia coli str. K-12 substr. MG1655]
MAKRTKAEALKTRQELIETAIAQFAQHGVSKTTLNDIADAANVTRGAIYWHFENKTQLFNEMWLQQPSLRELIQEHLTAGLEHDPFQQLR
EKLIVGLQYIAKIPRQQALLKILYHKCEFNDEMLAEGVIREKMGFNPQTLREVLQACQQQGCVANNLDLDVVMIIIDGAFSGIVQNWLMN
MAGYDLYKQAPALVDNVLRMFMPDENITKLIHQTNELSVM


>gb|U00096.1|-|3412803-3413465|AcrS [Escherichia coli str. K-12 substr. MG1655]
ATGGCAAAAAGAACCAAAGCCGAAGCTCTGAAGACCCGGCAAGAACTGATTGAAACTGCCATCGCCCAGTTTGCGCAGCATGGCGTAAGC
AAGACGACGCTCAACGACATTGCCGACGCCGCTAACGTTACGCGTGGCGCTATCTACTGGCACTTCGAAAACAAGACTCAACTGTTTAAT
GAGATGTGGTTGCAACAGCCTTCATTGCGGGAGTTAATCCAGGAACACTTGACGGCTGGATTAGAGCATGACCCGTTTCAACAATTGCGT
GAAAAATTGATTGTCGGCTTGCAATATATTGCCAAAATTCCCCGCCAGCAGGCGTTGCTGAAAATCTTATATCACAAATGTGAATTTAAT
GATGAGATGCTGGCCGAGGGAGTGATACGCGAAAAGATGGGCTTTAATCCGCAGACTCTCCGCGAAGTATTGCAGGCGTGTCAGCAACAA
GGTTGTGTAGCAAATAACCTCGATTTAGATGTTGTGATGATTATTATTGATGGTGCCTTCAGCGGAATTGTTCAAAACTGGTTAATGAAT
ATGGCGGGTTATGATCTTTATAAACAAGCCCCCGCTCTGGTCGATAACGTATTAAGAATGTTCATGCCAGATGAAAACATAACGAAATTA
ATTCATCAAACGAATGAATTAAGTGTCATGTAA

Curator Acknowledgements
Curator Description Most Recent Edit