CTX-M-15

Accession ARO:3001878
Synonym(s)UOE-1
DefinitionCTX-M-15 is a beta-lactamase found in the Enterobacteriaceae family
AMR Gene FamilyCTX-M beta-lactamase
Drug Classcephalosporin
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Citrobacter freundiip+wgs, Enterobacter asburiaewgs, Enterobacter cloacaeg+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Escherichia colig+p+wgs, Klebsiella aerogeneswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiig+wgs, Proteus mirabiliswgs, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella dysenteriaewgs, Shigella flexneriwgs, Shigella sonneip+wgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Citrobacter freundiip+wgs, Enterobacter asburiaewgs, Enterobacter cloacaeg+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Escherichia colig+p+wgs, Klebsiella aerogeneswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiig+wgs, Proteus mirabiliswgs, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella dysenteriaewgs, Shigella flexneriwgs, Shigella sonneip+wgs, Vibrio choleraewgs
Classification13 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ CTX-M beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
Publications

Karim A, et al. 2001. FEMS Microbiol Lett 201(2): 237-241. Plasmid-mediated extended-spectrum beta-lactamase (CTX-M-3 like) from India and gene association with insertion sequence ISEcp1. (PMID 11470367)

Poirel L, et al. 2002. J. Antimicrob. Chemother. 50(6):1031-4 Biochemical analysis of the ceftazidime-hydrolysing extended-spectrum beta-lactamase CTX-M-15 and of its structurally related beta-lactamase CTX-M-3. (PMID 12461028)

Resistomes

Prevalence of CTX-M-15 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.14%
Citrobacter freundii0%1.89%10.19%
Enterobacter asburiae0%0%1.19%
Enterobacter cloacae4.65%0%6.84%
Enterobacter hormaechei3.23%1.1%14.91%
Enterobacter kobei0%0%2.9%
Escherichia coli1.66%1.03%7.41%
Klebsiella aerogenes0%0%1.88%
Klebsiella oxytoca0%0%0.78%
Klebsiella pneumoniae11.18%3.71%33.48%
Morganella morganii5.88%0%5.36%
Proteus mirabilis0%0%1.12%
Providencia rettgeri0%0%6.25%
Providencia stuartii0%0%4.17%
Pseudomonas aeruginosa0%0%0.04%
Salmonella enterica0.3%0.72%0.2%
Serratia marcescens0%3.41%2.91%
Shigella dysenteriae0%0%2.94%
Shigella flexneri0%0%1.66%
Shigella sonnei0%1.61%1.55%
Vibrio cholerae0%0%0.16%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|AAL02127.1|+|CTX-M-15 [Escherichia coli]
MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKKSESE
PNLLNQRVEIKKSDLVNYNPIAEKHVNGTMSLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP
RDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGGYGTTNDIAVIWPKDRAPLILVTYFTQPQ
PKAESRRDVLASAAKIVTDGL


>gb|AY044436|+|1436-2311|CTX-M-15 [Escherichia coli]
ATGGTTAAAAAATCACTGCGCCAGTTCACGCTGATGGCGACGGCAACCGTCACGCTGTTGTTAGGAAGTGTGCCGCTGTATGCGCAAACG
GCGGACGTACAGCAAAAACTTGCCGAATTAGAGCGGCAGTCGGGAGGCAGACTGGGTGTGGCATTGATTAACACAGCAGATAATTCGCAA
ATACTTTATCGTGCTGATGAGCGCTTTGCGATGTGCAGCACCAGTAAAGTGATGGCCGCGGCCGCGGTGCTGAAGAAAAGTGAAAGCGAA
CCGAATCTGTTAAATCAGCGAGTTGAGATCAAAAAATCTGACCTTGTTAACTATAATCCGATTGCGGAAAAGCACGTCAATGGGACGATG
TCACTGGCTGAGCTTAGCGCGGCCGCGCTACAGTACAGCGATAACGTGGCGATGAATAAGCTGATTGCTCACGTTGGCGGCCCGGCTAGC
GTCACCGCGTTCGCCCGACAGCTGGGAGACGAAACGTTCCGTCTCGACCGTACCGAGCCGACGTTAAACACCGCCATTCCGGGCGATCCG
CGTGATACCACTTCACCTCGGGCAATGGCGCAAACTCTGCGGAATCTGACGCTGGGTAAAGCATTGGGCGACAGCCAACGGGCGCAGCTG
GTGACATGGATGAAAGGCAATACCACCGGTGCAGCGAGCATTCAGGCTGGACTGCCTGCTTCCTGGGTTGTGGGGGATAAAACCGGCAGC
GGTGGCTATGGCACCACCAACGATATCGCGGTGATCTGGCCAAAAGATCGTGCGCCGCTGATTCTGGTCACTTACTTCACCCAGCCTCAA
CCTAAGGCAGAAAGCCGTCGCGATGTATTAGCGTCGGCGGCTAAAATCGTCACCGACGGTTTGTAA