CTX-M-15

Accession ARO:3001878
Synonym(s)UOE-1
CARD Short NameCTX-M-15
DefinitionCTX-M-15 is a beta-lactamase found in the Enterobacteriaceae family.
AMR Gene FamilyCTX-M beta-lactamase
Drug Classpenicillin beta-lactam, cephalosporin
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniig+wgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia marmotaewgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+wgs, Proteus mirabilisg+wgs, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+wgs, Raoultella planticolawgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella boydiiwgs, Shigella dysenteriaewgs, Shigella flexnerig+p+wgs, Shigella sonneig+p+wgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia marmotaewgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+wgs, Proteus mirabilisg+wgs, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+wgs, Raoultella planticolawgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella boydiiwgs, Shigella dysenteriaewgs, Shigella flexnerig+p+wgs, Shigella sonneig+p+wgs, Vibrio choleraewgs, Vibrio parahaemolyticuswgs
Classification16 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic cefazolin [Antibiotic]
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ CTX-M beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
Sub-Term(s)
12 ontology terms | Show
+ tazobactam [Adjuvant] is_small_molecule_inhibitor
+ clavulanic acid [Adjuvant] is_small_molecule_inhibitor
+ sulbactam [Adjuvant] is_small_molecule_inhibitor
+ ANT3310 [Adjuvant] is_small_molecule_inhibitor
+ avibactam [Adjuvant] is_small_molecule_inhibitor
+ vaborbactam [Adjuvant] is_small_molecule_inhibitor
+ Xeruborbactam [Adjuvant] is_small_molecule_inhibitor
+ taniborbactam [Adjuvant] is_small_molecule_inhibitor
+ nacubactam [Adjuvant] is_small_molecule_inhibitor
+ ARX1796 [Adjuvant] is_small_molecule_inhibitor
+ ledaborbactam [Adjuvant] is_small_molecule_inhibitor
+ ledaborbactam etzadroxil [Adjuvant] is_small_molecule_inhibitor
Publications

Karim A, et al. 2001. FEMS Microbiol Lett 201(2): 237-241. Plasmid-mediated extended-spectrum beta-lactamase (CTX-M-3 like) from India and gene association with insertion sequence ISEcp1. (PMID 11470367)

Poirel L, et al. 2002. J. Antimicrob. Chemother. 50(6):1031-4 Biochemical analysis of the ceftazidime-hydrolysing extended-spectrum beta-lactamase CTX-M-15 and of its structurally related beta-lactamase CTX-M-3. (PMID 12461028)

Tsang KK, et al. 2021. Microb Genom 7(1): Identifying novel β-lactamase substrate activity through in silico prediction of antimicrobial resistance. (PMID 33416461)

Resistomes

Prevalence of CTX-M-15 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.35%0%0.36%0%0%
Citrobacter freundii0%0.62%11.61%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%0%4.5%0%0%
Citrobacter werkmanii0%0%56.41%0%0%
Citrobacter youngae0%0%6.25%0%0%
Enterobacter asburiae0%0.28%5.14%0%0%
Enterobacter chengduensis0%0%12%0%0%
Enterobacter cloacae1.79%0.56%11.5%0%0%
Enterobacter hormaechei0.72%1.03%12.86%0%0%
Enterobacter kobei0%0%3.06%0%0%
Enterobacter roggenkampii0%0%0.36%0%0%
Escherichia coli2.55%1.48%10.29%0%0%
Escherichia marmotae0%0%4.17%0%0%
Klebsiella aerogenes0%1.09%2.54%0%0%
Klebsiella michiganensis6.45%2.29%9.84%0%0%
Klebsiella oxytoca0%4.11%3.36%0%0%
Klebsiella pneumoniae10.83%5.4%33.36%0%0%
Klebsiella quasipneumoniae0%1.48%16.84%0%0%
Morganella morganii1.92%0%2.45%0%0%
Proteus mirabilis1.83%0%9.9%0%0%
Providencia rettgeri0%0%2.55%0%0%
Providencia stuartii0%0%2.27%0%0%
Pseudomonas aeruginosa0.15%0%0.04%0%0%
Raoultella planticola0%0%2.56%0%0%
Salmonella enterica0.06%0.77%0.33%0%0%
Serratia marcescens0%1.94%3.01%0%0%
Shigella boydii0%0%6.67%0%0%
Shigella dysenteriae0%0%3.33%0%0%
Shigella flexneri1%2.81%1.55%0%0%
Shigella sonnei9.76%6.8%2.56%0%0%
Vibrio cholerae0%0%0.13%0%0%
Vibrio parahaemolyticus0%0%0.21%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AAL02127.1|+|CTX-M-15 [Escherichia coli]
MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKKSESE
PNLLNQRVEIKKSDLVNYNPIAEKHVNGTMSLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP
RDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGGYGTTNDIAVIWPKDRAPLILVTYFTQPQ
PKAESRRDVLASAAKIVTDGL


>gb|AY044436.1|+|1436-2311|CTX-M-15 [Escherichia coli]
ATGGTTAAAAAATCACTGCGCCAGTTCACGCTGATGGCGACGGCAACCGTCACGCTGTTGTTAGGAAGTGTGCCGCTGTATGCGCAAACG
GCGGACGTACAGCAAAAACTTGCCGAATTAGAGCGGCAGTCGGGAGGCAGACTGGGTGTGGCATTGATTAACACAGCAGATAATTCGCAA
ATACTTTATCGTGCTGATGAGCGCTTTGCGATGTGCAGCACCAGTAAAGTGATGGCCGCGGCCGCGGTGCTGAAGAAAAGTGAAAGCGAA
CCGAATCTGTTAAATCAGCGAGTTGAGATCAAAAAATCTGACCTTGTTAACTATAATCCGATTGCGGAAAAGCACGTCAATGGGACGATG
TCACTGGCTGAGCTTAGCGCGGCCGCGCTACAGTACAGCGATAACGTGGCGATGAATAAGCTGATTGCTCACGTTGGCGGCCCGGCTAGC
GTCACCGCGTTCGCCCGACAGCTGGGAGACGAAACGTTCCGTCTCGACCGTACCGAGCCGACGTTAAACACCGCCATTCCGGGCGATCCG
CGTGATACCACTTCACCTCGGGCAATGGCGCAAACTCTGCGGAATCTGACGCTGGGTAAAGCATTGGGCGACAGCCAACGGGCGCAGCTG
GTGACATGGATGAAAGGCAATACCACCGGTGCAGCGAGCATTCAGGCTGGACTGCCTGCTTCCTGGGTTGTGGGGGATAAAACCGGCAGC
GGTGGCTATGGCACCACCAACGATATCGCGGTGATCTGGCCAAAAGATCGTGCGCCGCTGATTCTGGTCACTTACTTCACCCAGCCTCAA
CCTAAGGCAGAAAGCCGTCGCGATGTATTAGCGTCGGCGGCTAAAATCGTCACCGACGGTTTGTAA

Curator Acknowledgements
Curator Description Most Recent Edit