KPC-2

Accession	ARO:3002312
Synonym(s)	KPC-1
CARD Short Name	KPC-2
Definition	KPC-2 is a beta-lactamase found in Klebsiella pneumoniae and Pseudomonas aeruginosa.
AMR Gene Family	KPC beta-lactamase
Drug Class	penicillin beta-lactam, cephalosporin, carbapenem, monobactam
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^wgs, Aeromonas caviae^g+p+wgs, Aeromonas hydrophila^p+wgs, Aeromonas veronii^p, Alcaligenes faecalis^wgs, Citrobacter amalonaticus^p+wgs, Citrobacter freundii^p+wgs, Citrobacter koseri^p+wgs, Citrobacter portucalensis^p+wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^p, Enterobacter asburiae^p+wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^g+p+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Morganella morganii^p+wgs, Proteus mirabilis^g+p+wgs, Pseudomonas aeruginosa^g+p+wgs, Raoultella planticola^p+wgs, Salmonella enterica^p+wgs, Serratia marcescens^p+wgs, Shigella sonnei^wgs, Staphylococcus aureus^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^wgs, Aeromonas caviae^g+p+wgs, Aeromonas hydrophila^p+wgs, Aeromonas veronii^p, Alcaligenes faecalis^wgs, Citrobacter amalonaticus^p+wgs, Citrobacter freundii^p+wgs, Citrobacter koseri^p+wgs, Citrobacter portucalensis^p+wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^p, Enterobacter asburiae^p+wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella huaxiensis^p, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^g+p+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Morganella morganii^p+wgs, Proteus mirabilis^g+p+wgs, Pseudomonas aeruginosa^g+p+wgs, Raoultella planticola^p+wgs, Salmonella enterica^p+wgs, Serratia marcescens^p+wgs, Shigella sonnei^wgs, Staphylococcus aureus^wgs
Classification	15 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + antibiotic molecule + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + beta-lactam antibiotic + beta-lactamase + class A beta-lactamase + penicillin beta-lactam [Drug Class] + cephalosporin [Drug Class] + carbapenem [Drug Class] + monobactam [Drug Class]
Parent Term(s)	1 ontology terms \| Show + KPC beta-lactamase [AMR Gene Family]
Sub-Term(s)	13 ontology terms \| Show + BLI-489 [Adjuvant] is_small_molecule_inhibitor + ANT3310 [Adjuvant] is_small_molecule_inhibitor + avibactam [Adjuvant] is_small_molecule_inhibitor + relebactam [Adjuvant] is_small_molecule_inhibitor + vaborbactam [Adjuvant] is_small_molecule_inhibitor + Xeruborbactam [Adjuvant] is_small_molecule_inhibitor + taniborbactam [Adjuvant] is_small_molecule_inhibitor + durlobactam [Adjuvant] is_small_molecule_inhibitor + nacubactam [Adjuvant] is_small_molecule_inhibitor + zidebactam [Adjuvant] is_small_molecule_inhibitor + ARX1796 [Adjuvant] is_small_molecule_inhibitor + ledaborbactam [Adjuvant] is_small_molecule_inhibitor + ledaborbactam etzadroxil [Adjuvant] is_small_molecule_inhibitor
Publications	Smith Moland E, et al. 2003. J Antimicrob Chemother 51(3): 711-714. Plasmid-mediated, carbapenem-hydrolysing beta-lactamase, KPC-2, in Klebsiella pneumoniae isolates. (PMID 12615876) Villegas MV, et al. 2007. Antimicrob. Agents Chemother. 51(4):1553-5 First identification of Pseudomonas aeruginosa isolates producing a KPC-type carbapenem-hydrolyzing beta-lactamase. (PMID 17261621)

Resistomes

Prevalence of KPC-2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	0%	0%	0.01%	0%	0%
Acinetobacter baumannii	0%	0%	0.01%	0%	0%
Aeromonas caviae	2.27%	3.9%	3.76%	0%	0%
Aeromonas caviae	2.27%	3.9%	3.76%	0%	0%
Aeromonas hydrophila	0%	10.39%	3.23%	0%	0%
Aeromonas hydrophila	0%	10.39%	3.23%	0%	0%
Aeromonas veronii	0%	3.08%	0%	0%	0%
Aeromonas veronii	0%	3.08%	0%	0%	0%
Alcaligenes faecalis	0%	0%	2.94%	0%	0%
Alcaligenes faecalis	0%	0%	2.94%	0%	0%
Citrobacter amalonaticus	0%	8.33%	1.82%	0%	0%
Citrobacter amalonaticus	0%	8.33%	1.82%	0%	0%
Citrobacter freundii	0%	9.54%	11.61%	0%	0%
Citrobacter freundii	0%	9.54%	11.61%	0%	0%
Citrobacter koseri	0%	15%	11.71%	0%	0%
Citrobacter koseri	0%	15%	11.71%	0%	0%
Citrobacter portucalensis	0%	13.24%	10.81%	0%	0%
Citrobacter portucalensis	0%	13.24%	9.91%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Citrobacter youngae	0%	9.09%	0%	0%	0%
Citrobacter youngae	0%	9.09%	0%	0%	0%
Enterobacter asburiae	0%	0.83%	3.16%	0%	0%
Enterobacter asburiae	0%	0.83%	3.16%	0%	0%
Enterobacter chengduensis	0%	0%	20%	0%	0%
Enterobacter chengduensis	0%	0%	20%	0%	0%
Enterobacter cloacae	0%	2.23%	5.11%	0%	0%
Enterobacter cloacae	0%	2.23%	5.11%	0%	0%
Enterobacter hormaechei	0%	1.42%	4.57%	0%	0%
Enterobacter hormaechei	0%	1.42%	4.57%	0%	0%
Enterobacter kobei	0%	2.07%	5.68%	0%	0%
Enterobacter kobei	0%	2.07%	5.68%	0%	0%
Enterobacter roggenkampii	0%	0%	8.27%	0%	0%
Enterobacter roggenkampii	0%	0%	8.27%	0%	0%
Escherichia coli	0.02%	0.4%	0.79%	0%	0%
Escherichia coli	0.02%	0.4%	0.8%	0%	0%
Klebsiella aerogenes	0%	11.96%	4.24%	0%	0%
Klebsiella aerogenes	0%	11.96%	4.24%	0%	0%
Klebsiella huaxiensis	0%	0%	0%	0%	0%
Klebsiella huaxiensis	0%	7.69%	0%	0%	0%
Klebsiella michiganensis	0%	10.29%	7.18%	0%	0%
Klebsiella michiganensis	0%	10.29%	7.18%	0%	0%
Klebsiella oxytoca	2.56%	5.48%	3.78%	0%	0%
Klebsiella oxytoca	2.56%	5.48%	3.78%	0%	0%
Klebsiella pneumoniae	0.65%	5.66%	21.05%	0%	0%
Klebsiella pneumoniae	0.65%	5.65%	21%	0%	0%
Klebsiella quasipneumoniae	0%	1.06%	5%	0%	0%
Klebsiella quasipneumoniae	0%	1.06%	5%	0%	0%
Morganella morganii	0%	12.5%	4.91%	0%	0%
Morganella morganii	0%	12.5%	4.91%	0%	0%
Proteus mirabilis	0.92%	13.75%	4.79%	0%	0%
Proteus mirabilis	0.92%	13.75%	4.79%	0%	0%
Pseudomonas aeruginosa	1.07%	9.65%	1.25%	0%	0%
Pseudomonas aeruginosa	1.07%	9.94%	1.25%	0%	0%
Raoultella planticola	0%	9.3%	15.38%	0%	0%
Raoultella planticola	0%	9.3%	15.38%	0%	0%
Salmonella enterica	0%	0.05%	0.02%	0%	0%
Salmonella enterica	0%	0.05%	0.02%	0%	0%
Serratia marcescens	0%	5.81%	8.39%	0%	0%
Serratia marcescens	0%	5.81%	8.39%	0%	0%
Shigella sonnei	0%	0%	0.22%	0%	0%
Shigella sonnei	0%	0%	0.22%	0%	0%
Staphylococcus aureus	0%	0%	0.01%	0%	0%
Staphylococcus aureus	0%	0%	0.01%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 550

Protein
DNA

>gb|AAK70220.1|+|KPC-2 [Klebsiella pneumoniae]
MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLL
DTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTS
SPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDD
KHSEAVIAAAARLALEGLGVNGQ

>gb|AY034847.1|+|6-887|KPC-2 [Klebsiella pneumoniae]
ATGTCACTGTATCGCCGTCTAGTTCTGCTGTCTTGTCTCTCATGGCCGCTGGCTGGCTTTTCTGCCACCGCGCTGACCAACCTCGTCGCG
GAACCATTCGCTAAACTCGAACAGGACTTTGGCGGCTCCATCGGTGTGTACGCGATGGATACCGGCTCAGGCGCAACTGTAAGTTACCGC
GCTGAGGAGCGCTTCCCACTGTGCAGCTCATTCAAGGGCTTTCTTGCTGCCGCTGTGCTGGCTCGCAGCCAGCAGCAGGCCGGCTTGCTG
GACACACCCATCCGTTACGGCAAAAATGCGCTGGTTCCGTGGTCACCCATCTCGGAAAAATATCTGACAACAGGCATGACGGTGGCGGAG
CTGTCCGCGGCCGCCGTGCAATACAGTGATAACGCCGCCGCCAATTTGTTGCTGAAGGAGTTGGGCGGCCCGGCCGGGCTGACGGCCTTC
ATGCGCTCTATCGGCGATACCACGTTCCGTCTGGACCGCTGGGAGCTGGAGCTGAACTCCGCCATCCCAGGCGATGCGCGCGATACCTCA
TCGCCGCGCGCCGTGACGGAAAGCTTACAAAAACTGACACTGGGCTCTGCACTGGCTGCGCCGCAGCGGCAGCAGTTTGTTGATTGGCTA
AAGGGAAACACGACCGGCAACCACCGCATCCGCGCGGCGGTGCCGGCAGACTGGGCAGTCGGAGACAAAACCGGAACCTGCGGAGTGTAT
GGCACGGCAAATGACTATGCCGTCGTCTGGCCCACTGGGCGCGCACCTATTGTGTTGGCCGTCTACACCCGGGCGCCTAACAAGGATGAC
AAGCACAGCGAGGCCGTCATCGCCGCTGCGGCTAGACTCGCGCTCGAGGGATTGGGCGTCAACGGGCAGTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

KPC-2

Prevalence: protein homolog model (view sequences)

Graph