Accession ARO:3002312
Synonym(s)KPC-1
CARD Short NameKPC-2
DefinitionKPC-2 is a beta-lactamase found in Klebsiella pneumoniae and Pseudomonas aeruginosa.
AMR Gene FamilyKPC beta-lactamase
Drug Classpenam, cephalosporin, carbapenem, monobactam
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilap+wgs, Aeromonas veroniip, Alcaligenes faecaliswgs, Citrobacter amalonaticusp+wgs, Citrobacter freundiip+wgs, Citrobacter koserip+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaep, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocag+p+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiip+wgs, Proteus mirabilisg+p+wgs, Pseudomonas aeruginosag+p+wgs, Raoultella planticolap+wgs, Salmonella entericap+wgs, Serratia marcescensp+wgs, Shigella sonneiwgs, Staphylococcus aureuswgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilap+wgs, Aeromonas veroniip, Alcaligenes faecaliswgs, Citrobacter amalonaticusp+wgs, Citrobacter freundiip+wgs, Citrobacter koserip+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaep, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella huaxiensisp, Klebsiella michiganensisp+wgs, Klebsiella oxytocag+p+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiip+wgs, Proteus mirabilisg+p+wgs, Pseudomonas aeruginosag+p+wgs, Raoultella planticolap+wgs, Salmonella entericap+wgs, Serratia marcescensp+wgs, Shigella sonneiwgs, Staphylococcus aureuswgs
Classification16 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ KPC beta-lactamase [AMR Gene Family]
Sub-Term(s)
13 ontology terms | Show
+ BLI-489 [Adjuvant] is_small_molecule_inhibitor
+ ANT3310 [Adjuvant] is_small_molecule_inhibitor
+ avibactam [Adjuvant] is_small_molecule_inhibitor
+ relebactam [Adjuvant] is_small_molecule_inhibitor
+ vaborbactam [Adjuvant] is_small_molecule_inhibitor
+ Xeruborbactam [Adjuvant] is_small_molecule_inhibitor
+ taniborbactam [Adjuvant] is_small_molecule_inhibitor
+ durlobactam [Adjuvant] is_small_molecule_inhibitor
+ nacubactam [Adjuvant] is_small_molecule_inhibitor
+ zidebactam [Adjuvant] is_small_molecule_inhibitor
+ ARX1796 [Adjuvant] is_small_molecule_inhibitor
+ ledaborbactam [Adjuvant] is_small_molecule_inhibitor
+ ledaborbactam etzadroxil [Adjuvant] is_small_molecule_inhibitor
Publications

Smith Moland E, et al. 2003. J Antimicrob Chemother 51(3): 711-714. Plasmid-mediated, carbapenem-hydrolysing beta-lactamase, KPC-2, in Klebsiella pneumoniae isolates. (PMID 12615876)

Villegas MV, et al. 2007. Antimicrob. Agents Chemother. 51(4):1553-5 First identification of Pseudomonas aeruginosa isolates producing a KPC-type carbapenem-hydrolyzing beta-lactamase. (PMID 17261621)

Resistomes

Prevalence of KPC-2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0%0.01%0%
Aeromonas caviae2.27%3.9%3.76%0%
Aeromonas hydrophila0%10.39%3.23%0%
Aeromonas veronii0%3.08%0%0%
Alcaligenes faecalis0%0%2.94%0%
Citrobacter amalonaticus0%8.33%1.82%0%
Citrobacter freundii0%9.54%6.77%0%
Citrobacter koseri0%15%9.91%0%
Citrobacter portucalensis0%13.24%9.91%0%
Citrobacter werkmanii0%0%2.56%0%
Citrobacter youngae0%9.09%0%0%
Enterobacter asburiae0%0.83%3.16%0%
Enterobacter chengduensis0%0%20%0%
Enterobacter cloacae0%2.23%5.11%0%
Enterobacter hormaechei0%1.42%3.84%0%
Enterobacter kobei0%2.07%4.8%0%
Enterobacter roggenkampii0%0%4.68%0%
Escherichia coli0.02%0.4%0.4%0%
Klebsiella aerogenes0%11.96%4.24%0%
Klebsiella huaxiensis0%15.38%0%0%
Klebsiella michiganensis0%10.86%6.91%0%
Klebsiella oxytoca2.56%5.48%2.94%0%
Klebsiella pneumoniae0.65%5.68%12.41%0%
Klebsiella quasipneumoniae0%1.06%4.61%0%
Morganella morganii0%12.5%4.29%0%
Proteus mirabilis0.92%13.75%1.65%0%
Pseudomonas aeruginosa1.07%9.94%0.53%0%
Raoultella planticola0%9.3%12.82%0%
Salmonella enterica0%0.05%0.02%0%
Serratia marcescens0%5.81%8.39%0%
Shigella sonnei0%0%0.22%0%
Staphylococcus aureus0%0%0.01%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 550


>gb|AAK70220.1|+|KPC-2 [Klebsiella pneumoniae]
MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLL
DTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTS
SPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDD
KHSEAVIAAAARLALEGLGVNGQ


>gb|AY034847.1|+|6-887|KPC-2 [Klebsiella pneumoniae]
ATGTCACTGTATCGCCGTCTAGTTCTGCTGTCTTGTCTCTCATGGCCGCTGGCTGGCTTTTCTGCCACCGCGCTGACCAACCTCGTCGCG
GAACCATTCGCTAAACTCGAACAGGACTTTGGCGGCTCCATCGGTGTGTACGCGATGGATACCGGCTCAGGCGCAACTGTAAGTTACCGC
GCTGAGGAGCGCTTCCCACTGTGCAGCTCATTCAAGGGCTTTCTTGCTGCCGCTGTGCTGGCTCGCAGCCAGCAGCAGGCCGGCTTGCTG
GACACACCCATCCGTTACGGCAAAAATGCGCTGGTTCCGTGGTCACCCATCTCGGAAAAATATCTGACAACAGGCATGACGGTGGCGGAG
CTGTCCGCGGCCGCCGTGCAATACAGTGATAACGCCGCCGCCAATTTGTTGCTGAAGGAGTTGGGCGGCCCGGCCGGGCTGACGGCCTTC
ATGCGCTCTATCGGCGATACCACGTTCCGTCTGGACCGCTGGGAGCTGGAGCTGAACTCCGCCATCCCAGGCGATGCGCGCGATACCTCA
TCGCCGCGCGCCGTGACGGAAAGCTTACAAAAACTGACACTGGGCTCTGCACTGGCTGCGCCGCAGCGGCAGCAGTTTGTTGATTGGCTA
AAGGGAAACACGACCGGCAACCACCGCATCCGCGCGGCGGTGCCGGCAGACTGGGCAGTCGGAGACAAAACCGGAACCTGCGGAGTGTAT
GGCACGGCAAATGACTATGCCGTCGTCTGGCCCACTGGGCGCGCACCTATTGTGTTGGCCGTCTACACCCGGGCGCCTAACAAGGATGAC
AAGCACAGCGAGGCCGTCATCGCCGCTGCGGCTAGACTCGCGCTCGAGGGATTGGGCGTCAACGGGCAGTAA