Enterobacter aerogenes acrR with mutation conferring multidrug antibiotic resistance

Accession ARO:3003374
CARD Short NameKaer_acrR_MULT
DefinitionAcrR is a repressor of the AcrAB-TolC multidrug efflux complex. AcrR mutations result in high level antibiotic resistance.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classtetracycline antibiotic, cephalosporin, rifamycin antibiotic, glycylcycline, disinfecting agents and antiseptics, penam, phenicol antibiotic, fluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux, antibiotic target alteration
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Classification30 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic acriflavine [Antibiotic]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
+ acrR
Publications

Pradel E and Pages JM. 2002. Antimicrob Agents Chemother 46(8): 2640-2643. The AcrAB-TolC efflux pump contributes to multidrug resistance in the nosocomial pathogen Enterobacter aerogenes. (PMID 12121946)

Resistomes

Prevalence of Enterobacter aerogenes acrR with mutation conferring multidrug antibiotic resistance among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 410

Legend:

  • discovered in clinical, agricultural, or environmental isolates

  • discovered via laboratory selection experiments

  • ReSeqTB https://platform.reseqtb.org

Published Variants:

PMID: 12121946R45C A47fs

>gb|CAC35723.1|-|Enterobacter aerogenes acrR with mutation conferring multidrug antibiotic resistance [Klebsiella aerogenes]
MARKTKQQALETRQLILDVALRLFSQQGVSSTSLAAIAKAAGVTRGAIYWHFKNKSDLFN
EIWSLSDASISDLEVEYRAKFPNDPLSVVREILVYILEATVVEERRRLMMEIIFHKCEFV
GEMAVVQQAQRSLWLESYDRIEQTLKDCITAQQLPANLLTRRAAILMRSYLSGLMENWLF
APESFNLHAEARAYVDALIEMYQTCPSLRSSSEVMA



>gb|AJ306389.1|-|637-1287|Enterobacter aerogenes acrR with mutation conferring multidrug antibiotic resistance [Klebsiella aerogenes]
ATGGCACGAAAAACCAAACAACAGGCACTTGAAACCCGGCAACTGATTCTTGACGTCGCCCTGCGATTGTTTTCGCAGCAAGGGGTATCA
TCTACCTCGTTGGCCGCGATTGCAAAAGCTGCTGGAGTGACCAGGGGCGCTATATACTGGCATTTCAAAAACAAATCCGATCTGTTTAAT
GAAATATGGAGTCTTTCTGACGCCAGCATTAGCGATCTCGAAGTTGAGTATCGGGCAAAATTCCCTAACGATCCACTGTCAGTTGTTCGC
GAAATACTGGTTTATATCCTCGAAGCGACGGTAGTAGAGGAGCGTAGGCGCCTGATGATGGAAATCATCTTCCATAAATGCGAATTTGTC
GGAGAAATGGCCGTTGTCCAACAAGCGCAGCGCAGTTTATGGCTTGAAAGCTACGATCGTATTGAGCAAACATTAAAAGATTGTATCACT
GCTCAACAATTACCTGCGAATTTACTCACTCGCCGTGCGGCAATTCTGATGCGCAGTTATCTTTCCGGATTAATGGAAAACTGGCTCTTT
GCACCAGAGAGTTTTAACCTTCATGCGGAAGCCCGTGCTTATGTCGATGCGCTGATTGAGATGTATCAGACCTGCCCGTCGCTACGAAGT
TCGTCTGAGGTCATGGCCTGA