Escherichia coli AcrR with mutation associated with multidrug resistance

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003807
CARD Short NameEcol_AcrR_MULT
DefinitionAcrR is a regulator and repressor of the AcrAB-TolC multidrug efflux complex in Escherichia coli. Certain mutations in AcrR are associated with increased tetracycline and fluoroquinolone resistance, among others, by deregulating the efflux activity of AcrAB-TolC.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classtetracycline antibiotic, penicillin beta-lactam, cephalosporin, disinfecting agents and antiseptics, phenicol antibiotic, rifamycin antibiotic, glycylcycline, fluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux, antibiotic target alteration
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification33 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ acrR
Resistomes with Sequence VariantsCitrobacter koserig+wgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+p+wgs, Escherichia marmotaeg+wgs, Salmonella entericawgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs
Publications

Webber MA, et al. 2005. Antimicrob. Agents Chemother. 49(10):4390-2 Contribution of mutation at amino acid 45 of AcrR to acrB expression and ciprofloxacin resistance in clinical and veterinary Escherichia coli isolates. (PMID 16189130)

Resistomes

Prevalence of Escherichia coli AcrR with mutation associated with multidrug resistance among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein overexpression model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter koseri100%0%100%0%0%
Escherichia albertii100%0%99.35%0%0%
Escherichia coli65.2%0.01%96.13%0%99.29%
Escherichia fergusonii100%0.36%98.91%0%0%
Escherichia marmotae100%0%95.83%0%0%
Salmonella enterica0%0%0.01%0%0%
Shigella boydii100%0%97.78%0%0%
Shigella dysenteriae100%0%100%0%0%
Shigella flexneri99%0%99.38%0%0%
Shigella sonnei100%0%97.81%0%0%
Show Perfect Only


Detection Models

Model Type: protein overexpression model

Model Definition: Protein Overexpression Models (POM) are similar to Protein Variant Models (PVM) in that they include a protein reference sequence, a curated BLASTP bitscore cut-off, and mapped resistance variants. Whereas PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, reporting only those with curated mutations conferring AMR, POMs are restricted to regulatory proteins and report both wild-type sequences and/or sequences with mutations leading to overexpression of efflux complexes. The former lead to efflux of antibiotics at basal levels, while the latter can confer clinical resistance. POMs include a protein reference sequence (often from wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Perfect RGI match is 100% identical to the wild-type reference protein sequence along its entire length, a Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value may or may not contain at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off may or may not contain at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 375

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
R45Csingle resistance variantPMID:16189130

>gb|AAC73566.1|+|Escherichia coli AcrR with mutation associated with multidrug resistance [Escherichia coli str. K-12 substr. MG1655]
MARKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFS
EIWELSESNIGELELEYQAKFPGDPLSVLREILIHVLESTVTEERRRLLMEIIFHKCEFV
GEMAVVQQAQRNLCLESYDRIEQTLKHCIEAKMLPADLMTRRAAIIMRGYISGLMENWLF
APQSFDLKKEARDYVAILLEMYLLCPTLRNPATNE



>gb|U00096.3|+|485761-486408|Escherichia coli AcrR with mutation associated with multidrug resistance [Escherichia coli str. K-12 substr. MG1655]
ATGGCACGAAAAACCAAACAAGAAGCGCAAGAAACGCGCCAACACATCCTCGATGTGGCTCTACGTCTTTTCTCACAGCAGGGGGTATCA
TCCACCTCGCTGGGCGAGATTGCAAAAGCAGCTGGCGTTACGCGCGGTGCAATCTACTGGCATTTTAAAGACAAGTCGGATTTGTTCAGT
GAGATCTGGGAACTGTCAGAATCCAATATTGGTGAACTAGAGCTTGAGTATCAGGCAAAATTCCCTGGCGATCCACTCTCAGTATTAAGA
GAGATATTAATTCATGTTCTTGAATCCACGGTGACAGAAGAACGGCGTCGATTATTGATGGAGATTATATTCCACAAATGCGAATTTGTC
GGAGAAATGGCTGTTGTGCAACAGGCACAACGTAATCTCTGTCTGGAAAGTTATGACCGTATAGAACAAACGTTAAAACATTGTATTGAA
GCGAAAATGTTGCCTGCGGATTTAATGACGCGTCGCGCAGCAATTATTATGCGCGGCTATATTTCCGGCCTGATGGAAAACTGGCTCTTT
GCCCCGCAATCTTTTGATCTTAAAAAAGAAGCCCGCGATTACGTTGCCATCTTACTGGAGATGTATCTCCTGTGCCCCACGCTTCGTAAT
CCTGCCACTAACGAATAA

Curator Acknowledgements
Curator Description Most Recent Edit