MexD

Accession ARO:3000801
DefinitionMexD is the multidrug inner membrane transporter of the MexCD-OprJ complex.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classtetracycline antibiotic, triclosan, aminocoumarin antibiotic, phenicol antibiotic, aminoglycoside antibiotic, penam, acridine dye, carbapenem, antibacterial free fatty acids, monobactam, macrolide antibiotic, glycylcycline, diaminopyrimidine antibiotic, fluoroquinolone antibiotic, cephalosporin
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification34 ontology terms | Show
Parent Term(s)4 ontology terms | Show
Publications

Srikumar R, et al. 1998. Antimicrob Agents Chemother 42(1): 65-71. Expression of Pseudomonas aeruginosa multidrug efflux pumps MexA-MexB-OprM and MexC-MexD-OprJ in a multidrug-sensitive Escherichia coli strain. (PMID 9449262)

Poole K, et al. 1996. Mol Microbiol 21(4): 713-724. Overexpression of the mexC-mexD-oprJ efflux operon in nfxB-type multidrug-resistant strains of Pseudomonas aeruginosa. (PMID 8878035)

Resistomes

Prevalence of MexD among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter freundii0%0%0%
Enterobacter cloacae0%0%0%
Escherichia coli0%0%0%
Klebsiella oxytoca0%0%0%
Klebsiella pneumoniae0%0%0%
Pseudomonas aeruginosa0%0%0%
Pseudomonas fluorescens3.7%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1950 1800


>gb|AAB41957.1|+|MexD [Pseudomonas aeruginosa]
MSEFFIKRPNFAWVVALFISLGGLLVISKLPVAQYPNVAPPQITITATYPGASAKVLVDSVTSVLEESLNGAKGLLYFESTNNSNGTAEI
VVTFEPGTDPDLAQVDVQNRLKKAEARMPQAVLTQGLQVEQTSAGFLLIYALSYKEGAQRSDTTALGDYAARNINNELRRLPGVGKLQFF
SSEAAMRVWIDPQKLVGFGLSIDDVSNAIRGQNVQVPAGAFGSAPGSSAQELTATLAVKGTLDDPQEFGQVVLRANEDGSLVPARRCRAP
GTRQGELQHFLATERHAHRGRGYPAVARGQRDPDPTLVKQRLAELSAFFPEDMQYSVPYDTSRFVDVAIEKVIHTLIEAMVLVFLVMFLF
LENVRYTLIPSIVVPVCLLGTLMVMYLLGFSVNMMTMFGMVLAIGILVDDAIVVVENVERIMAEEGISPAEATVKAMKQVSGAIVGITLV
LSAVFLPLAFMAGSVGVIYQQFSVSLAVSILFSGFLALTFTPALCATLFKPIPEGHHEKRGFFGAFNRGFARVTERYSLLNSKLVARAGR
FMLVYAGLVAMLGYFYLRLPEAFVPAEDLGYMVVDVQLPPGASRVRTDATGEELERFLKSREAVASVFLISGFSFSGQGDNAALAFPTFK
DWSERGAEQSSAAEIAALNEHFALPDDGTVMAVSPPPINGLGNSGGFALRLMDRSGVGREALLQARDTLLGEIQTNPKFLYAMMEGLAEA
PQLRLLIDREKARALGVSFETISGTLSAAFGSEVINDFTNAGRQQRVVIQAEQGNRMTPESVLELYVPNAAGNLVPLSAFVSVKWEEGPV
QLVRYNGYPSIRIVGDAAPGFSTGEAMAEMERLASQLPAGIGYEWTGLSYQEKVSAGQATSLFALAILVVFLLLVALYESWSIPLSVMLI
VPIGAIGAVLAVMVSGMSNDVYFKVGLITIIGLSAKNAILIVEFAKELWEQGHSLRDAAIEAARLRFRPIIMTSMAFILGVIPLALASGA
GAASQRAIGTGVIGGMLSATFLGVLFVPICFVWLLSLLRSKPAPIEQAASAGE


>gb|U57969|+|1486-4617|MexD [Pseudomonas aeruginosa]
ATGTCCGAATTCTTCATCAAGCGGCCGAACTTCGCCTGGGTGGTGGCCCTGTTCATCTCCCTGGGCGGCCTGCTGGTCATTTCCAAATTG
CCGGTAGCGCAGTACCCCAATGTCGCGCCGCCACAGATCACCATCACCGCCACCTATCCCGGCGCCTCGGCGAAGGTGCTGGTGGACTCC
GTCACCAGTGTGCTCGAGGAGTCGCTGAACGGCGCCAAGGGCCTGCTCTACTTCGAGTCGACCAACAACTCCAACGGCACCGCCGAGATC
GTCGTCACCTTCGAGCCGGGCACCGATCCGGACCTGGCCCAGGTGGACGTGCAGAACCGCCTGAAGAAAGCCGAGGCGCGCATGCCGCAG
GCGGTGCTGACCCAGGGCCTGCAGGTCGAGCAGACCAGCGCCGGTTTCCTGCTGATCTATGCGCTCAGCTACAAGGAAGGCGCTCAGCGC
AGCGACACCACCGCCCTCGGCGACTACGCCGCGCGCAATATCAACAACGAGCTGCGGCGCCTGCCGGGCGTCGGCAAGCTGCAATTCTTC
TCTTCCGAGGCGGCCATGCGGGTCTGGATCGATCCGCAGAAGCTGGTGGGCTTCGGCCTCTCCATCGACGACGTGAGCAATGCCATCCGC
GGGCAGAACGTGCAGGTGCCGGCCGGCGCCTTCGGCAGCGCACCGGGCAGTTCCGCGCAGGAGCTGACGGCGACCCTGGCGGTGAAGGGC
ACCCTGGACGATCCGCAGGAGTTCGGCCAGGTAGTGCTGCGCGCCAACGAGGACGGCTCGCTGGTCCCGGCTCGCCGATGTCGCGCGCCT
GGAACTCGGCAAGGAGAGCTACAACATTTCCTCGCGACTGAACGGCACGCCCACCGTGGGCGGGGCTATCCAGCTGTCGCCCGGGGCCAA
CGCGATCCAGACCCTACCCTGGTGAAACAGCGTCTCGCCGAACTGTCGGCGTTCTTCCCCGAGGACATGCAGTACAGCGTGCCCTACGAC
ACCTCGCGCTTCGTCGACGTGGCCATCGAGAAGGTGATCCACACCCTGATCGAAGCGATGGTCCTGGTGTTCCTGGTGATGTTCCTGTTC
CTGGAGAACGTCCGCTACACCCTGATCCCGTCCATCGTGGTGCCGGTGTGCCTGCTGGGTACGCTGATGGTGATGTACCTGCTGGGGTTC
TCGGTGAACATGATGACCATGTTCGGCATGGTCCTGGCGATCGGCATCCTGGTGGACGACGCCATCGTGGTGGTGGAGAACGTCGAGCGG
ATCATGGCGGAGGAGGGGATTTCCCCGGCCGAGGCCACGGTCAAGGCGATGAAGCAGGTATCCGGCGCCATCGTCGGCATCACCCTGGTG
CTCTCGGCGGTGTTCCTGCCGCTGGCTTTCATGGCCGGTTCGGTGGGGGTGATCTACCAGCAGTTCTCGGTGTCGCTGGCGGTCTCGATC
CTGTTCTCCGGCTTCCTCGCCCTGACCTTCACCCCGGCGCTGTGCGCCACGCTGTTCAAGCCCATTCCCGAAGGGCACCACGAGAAGCGC
GGCTTCTTCGGCGCCTTCAACCGTGGCTTCGCCCGCGTCACCGAGCGCTATTCGCTGCTCAACTCGAAGCTGGTGGCGCGCGCCGGACGC
TTCATGCTGGTGTACGCCGGCCTGGTGGCCATGCTCGGCTACTTCTACCTGCGCCTGCCGGAAGCCTTCGTGCCGGCGGAAGACCTCGGC
TACATGGTGGTCGACGTGCAACTGCCGCCTGGCGCTTCGCGCGTGCGCACCGATGCCACCGGCGAGGAGCTCGAGCGCTTCCTCAAGTCC
CGCGAGGCGGTGGCTTCGGTGTTCCTGATCTCGGGCTTCAGCTTCTCCGGCCAGGGCGACAATGCCGCGCTGGCCTTCCCAACCTTCAAG
GACTGGTCCGAGCGAGGCGCCGAGCAGTCGTCCGCCGCCGAGATCGCCGCGCTGAACGAGCATTTCGCGCTGCCCGACGATGGCACGGTC
ATGGCCGTGTCGCCGCCACCGATCAACGGTCTGGGTAACTCCGGCGGCTTCGCATTGCGCCTGATGGACCGTAGCGGGGTCGGCCGCGAA
GCGCTGCTGCAGGCTCGCGATACTCTTCTTGGCGAGATCCAGACCAACCCGAAATTCCTTTACGCGATGATGGAAGGACTGGCCGAAGCG
CCGCAACTGCGCCTGTTGATCGACCGGGAGAAGGCCCGTGCCCTGGGGGTGAGCTTCGAGACCATCAGCGGCACGCTGTCCGCTGCCTTC
GGCTCGGAGGTGATCAACGACTTCACCAATGCGGGGCGCCAACAGCGGGTGGTGATCCAGGCCGAACAGGGCAACCGGATGACCCCGGAA
AGCGTGCTCGAGCTATACGTGCCTAACGCTGCTGGCAACCTGGTACCGCTCAGCGCCTTCGTCAGCGTGAAATGGGAAGAGGGACCGGTG
CAATTGGTGCGCTATAACGGCTACCCGTCGATCCGCATCGTCGGTGACGCCGCGCCCGGCTTCAGTACCGGCGAAGCCATGGCGGAAATG
GAGCGCCTGGCCTCGCAGCTGCCGGCCGGCATCGGCTACGAGTGGACCGGCCTGTCCTATCAGGAGAAGGTCTCCGCCGGGCAGGCCACC
AGCCTGTTCGCCCTCGCCATCCTGGTGGTGTTCCTGTTGCTGGTGGCGCTCTACGAGAGCTGGTCGATCCCGCTGTCGGTGATGCTGATC
GTGCCGATCGGCGCCATCGGCGCGGTGCTCGCGGTGATGGTCAGCGGTATGTCCAACGACGTGTATTTCAAGGTCGGCCTGATCACCATC
ATCGGTCTTTCGGCGAAGAACGCGATCCTCATCGTCGAGTTCGCCAAGGAACTCTGGGAACAGGGACATAGCCTGCGCGACGCCGCCATC
GAGGCCGCGCGCCTGCGCTTCCGGCCGATCATCATGACTTCCATGGCGTTCATCCTCGGCGTGATACCCCTGGCCCTGGCCAGCGGTGCC
GGCGCGGCGAGCCAGCGTGCCATCGGCACCGGAGTGATCGGCGGGATGCTCAGCGCCACCTTCCTCGGCGTGCTGTTCGTACCTATCTGT
TTCGTCTGGCTGCTGTCGCTGCTGCGCAGCAAGCCGGCACCCATCGAACAGGCCGCTTCGGCCGGGGAGTGA