ramA

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000823
CARD Short NameramA
DefinitionRamA (resistance antibiotic multiple) is a positive regulator of AcrAB-TolC and leads to high level multidrug resistance in Klebsiella pneumoniae, Salmonella enterica, and Enterobacter aerugenes, increasing the expression of both the mar operon as well as AcrAB. RamA also decreases OmpF expression.
AMR Gene FamilyGeneral Bacterial Porin with reduced permeability to beta-lactams, resistance-nodulation-cell division (RND) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classtetracycline antibiotic, penicillin beta-lactam, cephalosporin, disinfecting agents and antiseptics, phenicol antibiotic, rifamycin antibiotic, glycylcycline, carbapenem, monobactam, fluoroquinolone antibiotic
Resistance Mechanismreduced permeability to antibiotic, antibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONKlebsiella pneumoniae (16), Salmonella (13), Salmonella enterica (6), Enterobacter cloacae (5), Enterobacter (4), Escherichia coli (4), Salmonella enterica subsp. enterica serovar Typhi (2)
GAZ
FOODON
ENVO
UBERONmembrane organ (5), bile (2), proliferative region (2)
Classification32 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ regulates porin OmpF
+ regulates AcrAB-TolC
+ antibiotic efflux regulatory protein [AMR Gene Family]
Resistomes with Sequence VariantsEnterobacter asburiaeg+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+wgs, Enterobacter hormaecheig+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiig+wgs, Klebsiella pneumoniaewgs
Publications

Chollet R, et al. 2004. Antimicrob Agents Chemother 48(7): 2518-2523. RamA is an alternate activator of the multidrug resistance cascade in Enterobacter aerogenes. (PMID 15215103)

Nikaido E, et al. 2008. J Biol Chem 283(35): 24245-24253. AcrAB multidrug efflux pump regulation in Salmonella enterica serovar Typhimurium by RamA in response to environmental signals. (PMID 18577510)

George AM, et al. 1995. Microbiology 141(PT 8): 1909-1920. Multidrug resistance in Klebsiella pneumoniae: a novel gene, ramA, confers a multidrug resistance phenotype in Escherichia coli. (PMID 7551053)

Schneiders T, et al. 2003. Antimicrob Agents Chemother 47(9): 2831-2837. Role of AcrR and ramA in fluoroquinolone resistance in clinical Klebsiella pneumoniae isolates from Singapore. (PMID 12936981)

Resistomes

Prevalence of ramA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Enterobacter asburiae45.16%0%92.49%0%0%
Enterobacter chengduensis0%0%100%0%0%
Enterobacter cloacae58.93%0%73.48%0%0%
Enterobacter hormaechei0.36%0%0.09%0%0%
Enterobacter kobei0%0%96.94%0%0%
Enterobacter roggenkampii2.33%0%96.4%0%0%
Klebsiella pneumoniae0%0%0.01%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 230


>gb|AFK13828.1|+|ramA [Enterobacter cloacae]
MINQEAEGESSMTISAQIIDTIVEWIDDNLHQPLRIEEIARHAGYSKWHLQRLFMQYKGESLGRYIRERKLLLAARDLRESDARVYDICL
RYGFDSQQTFTRIFTRTFNQPPGAYRKENHSRAH


>gb|JQ727668.1|+|1-375|ramA [Enterobacter cloacae]
ATGATCAATCAGGAAGCTGAAGGGGAGAGCAGTATGACCATTTCCGCTCAAATCATCGACACTATCGTCGAGTGGATCGACGATAACCTG
CACCAGCCATTACGTATCGAAGAGATTGCCCGCCATGCGGGTTACTCGAAATGGCACCTGCAGCGGCTGTTTATGCAATACAAAGGGGAG
AGTCTGGGGCGCTATATCCGTGAACGCAAGCTGCTGCTGGCGGCGCGGGATCTGCGCGAATCAGACGCCCGGGTATACGACATCTGCCTG
CGTTACGGGTTTGACTCGCAGCAGACCTTCACTCGCATCTTCACCCGCACGTTCAACCAGCCGCCTGGGGCGTATCGTAAAGAGAACCAC
AGCCGCGCGCACTGA

Curator Acknowledgements
Curator Description Most Recent Edit