mexY

Accession ARO:3003033
CARD Short NamemexY
DefinitionMexY is the RND-type membrane protein of the efflux complex MexXY-OprM.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classaminoglycoside antibiotic, phenicol antibiotic, fluoroquinolone antibiotic, macrolide antibiotic, tetracycline antibiotic, disinfecting agents and antiseptics, carbapenem, cephamycin, cephalosporin, penam
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Sequence VariantsAchromobacter xylosoxidanswgs, Acinetobacter baumanniiwgs, Enterobacter cloacaewgs, Escherichia coliwgs, Klebsiella pneumoniaewgs, Pseudomonas aeruginosag+wgs, Stenotrophomonas maltophiliawgs, Vibrio vulnificuswgs
Classification33 ontology terms | Show
Parent Term(s)3 ontology terms | Show
Publications

Mine T, et al. 1999. Antimicrob Agents Chemother 43(2): 415-417. Expression in Escherichia coli of a new multidrug efflux pump, MexXY, from Pseudomonas aeruginosa. (PMID 9925549)

Resistomes

Prevalence of mexY among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Achromobacter xylosoxidans0%0%4.07%0%
Acinetobacter baumannii0%0%0.02%0%
Enterobacter cloacae0%0%0.36%0%
Escherichia coli0%0%0.01%0%
Klebsiella pneumoniae0%0%0.02%0%
Pseudomonas aeruginosa81.61%0%61.86%0%
Stenotrophomonas maltophilia0%0%0.34%0%
Vibrio vulnificus0%0%0.4%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 1800


>gb|BAA34300.1|+|mexY [Pseudomonas aeruginosa PAO1]
MARFFIDRPVFAWVISLLIVLAGVLAIRFLPVAQYPDIAPPVVNVSATYPGASAKVVEEAVTAIIEREMNGAPGLLYTKATSSTGQASLT
LTFRQGVNANLAAVEVQNRLKIVESRLPESVRRDGIYVEKAADSIQLIVTLTSSSGRYDAMELGEIASSNVLQALRRVEGVGKVETWGAE
YAMRIWPDPAKLTSMNLSASDLVNAVRRHNARLTVGDIGNLGVPDSAPISATVKVDDTLVTPEQFGEIPLAHPRDGGAIRLRDVARVEFG
QSEYGFVSRVNQMTATGLAVKMAPGSNAVATAKRIRATLDELSRYFPEGVSYNIPYDTSAFVEISIRKVVSTLLEAMLLVFAVMYLFMQN
FRATLIPTLVVPVALLGTFTVMLGLGFSINVLTMFGMVLAIGILVDDAIIVVENVERLMAEEGLSPHDATVKAMRQISGAIVGITVVLVS
VFVPMAFFSGAVGNIYRQFAVTLAVSIGFSAFLALSLTPALCATLLRPIDADHHEKRGFFGWFNRAFLRLTGRYRNAVAGILARPIRWML
VYTLVIGVVALLFVRLPQAFLPEEDQGDFMIMVMQPEGTPMAETMANVGDVERYLAEHEPVAYAYAVGGFSLYGDGTSSAMIFATLKDWS
ERREASQHVGAIVERINQRFAGLPNRTVYAMNSPPLPDLGSTSGFDFRLQDRGGVGYEALVKARDQLLARAAEDPRLANVMFAGQGEAPQ
IRLDIDRRKAETLGVSMDEINTTLAVMFGSDYIGDFMHGSQVRKVVVQADRRKRLGIDDIGRLHVRNEQGEMGAAGDVRQGRLDPRPAAT
DPLQRLSLVQPRGPGRAGLQQREAMQAMEQLMQGTARGIRPRVVRPVLRRTPVAGAQAPALFALSVLIVFLALAALYESWSIPLAVILVV
PLGVLGALLGVSLRGLPNDIYFKVGLITIIGLSAKNAILIIEVAKDHYQEGMSLLQATLEAARLRLRPIVMTSLAFGFGVVPLALSSGAG
IRAQVAIGTGVLGGIVTATVLAVFLVPLFFLVVGRLFRLRKAPRTGNSPQIPTEQA


>gb|AB015853.1|+|1331-4471|mexY [Pseudomonas aeruginosa PAO1]
ATGGCTCGTTTCTTCATTGACCGGCCGGTCTTCGCCTGGGTGATCTCCCTGCTGATCGTGCTCGCCGGGGTCCTGGCGATCCGCTTCCTG
CCGGTCGCCCAGTACCCGGACATCGCGCCGCCGGTGGTCAACGTCAGCGCCACGTATCCCGGCGCCTCGGCCAAGGTGGTCGAGGAAGCG
GTGACCGCGATCATCGAGCGCGAGATGAACGGCGCGCCCGGCCTGCTCTACACCAAGGCCACCAGCAGCACCGGCCAGGCCTCGCTGACC
CTGACCTTCCGCCAGGGCGTGAACGCGAACCTCGCCGCGGTGGAAGTGCAGAACCGCCTGAAGATCGTCGAGTCGCGCCTGCCCGAATCG
GTGCGGCGCGACGGCATCTACGTGGAGAAGGCGGCGGACAGCATCCAGCTGATCGTTACCCTTACCTCCTCCAGCGGCCGCTACGACGCC
ATGGAGCTGGGCGAGATCGCCTCGTCCAACGTGTTGCAGGCGCTGCGCCGGGTGGAGGGCGTGGGCAAGGTCGAGACCTGGGGCGCCGAG
TACGCCATGCGCATCTGGCCCGACCCGGCCAAGCTGACCTCGATGAACCTCAGCGCCAGCGACCTGGTCAACGCCGTGCGCCGGCACAAC
GCCCGCCTCACCGTGGGCGACATCGGCAACCTCGGGGTCCCCGACTCGGCGCCGATCAGCGCCACGGTGAAGGTCGACGACACCCTGGTG
ACGCCCGAGCAGTTCGGCGAAATTCCGCTGGCGCATCCGCGCGACGGCGGCGCGATCCGCCTGCGCGACGTGGCCCGCGTCGAGTTCGGC
CAGAGCGAGTACGGCTTCGTCTCGCGGGTCAACCAAATGACCGCCACCGGCCTGGCGGTGAAGATGGCGCCCGGCTCCAACGCGGTGGCC
ACCGCCAAGCGCATCCGCGCCACCCTCGACGAGCTGTCGCGCTACTTCCCGGAGGGCGTGAGCTACAACATCCCCTATGACACCTCGGCG
TTCGTCGAGATCTCGATCAGGAAGGTGGTCAGCACCCTGCTCGAGGCGATGCTGCTGGTGTTCGCCGTGATGTACCTGTTCATGCAGAAC
TTCCGCGCCACCCTGATCCCGACACTGGTGGTGCCGGTGGCCCTGCTGGGCACCTTCACGGTGATGCTCGGCCTGGGCTTCTCGATCAAC
GTGCTGACCATGTTCGGCATGGTCCTGGCGATCGGCATCCTGGTGGACGACGCGATCATCGTGGTGGAGAACGTCGAGCGGCTGATGGCC
GAGGAAGGCCTGTCGCCGCACGACGCCACGGTCAAGGCGATGCGCCAGATCAGCGGGGCCATCGTCGGCATCACCGTAGTGCTGGTCTCG
GTGTTCGTGCCGATGGCGTTCTTCAGCGGCGCGGTGGGCAACATCTACCGCCAGTTCGCGGTGACCCTGGCGGTCTCCATCGGCTTCTCG
GCGTTCCTCGCGCTGTCGCTGACCCCGGCCCTGTGCGCCACCCTGCTGCGCCCGATCGACGCCGACCACCACGAGAAGCGCGGCTTCTTC
GGCTGGTTCAACCGCGCCTTCCTGCGCCTGACCGGACGCTACCGCAACGCGGTGGCCGGCATCCTCGCCCGGCCGATCCGCTGGATGCTG
GTCTACACCCTGGTCATCGGCGTGGTCGCCCTGCTCTTCGTGCGCCTGCCGCAGGCGTTCCTGCCGGAAGAGGACCAGGGCGACTTCATG
ATCATGGTGATGCAGCCCGAAGGCACGCCGATGGCGGAGACCATGGCCAACGTCGGCGACGTCGAGCGCTACCTGGCGGAGCACGAACCG
GTGGCCTACGCCTATGCGGTCGGCGGCTTCAGCCTGTACGGCGACGGCACCAGCTCGGCGATGATCTTCGCCACCCTGAAGGACTGGTCG
GAACGCCGGGAGGCCAGCCAGCACGTCGGCGCCATCGTCGAGCGCATCAACCAGCGCTTCGCCGGCCTGCCCAACCGTACGGTGTATGCG
ATGAACTCGCCGCCGCTGCCGGACCTGGGTTCCACCAGCGGCTTCGACTTCCGCCTGCAGGACCGTGGCGGGGTTGGCTACGAGGCCCTG
GTCAAGGCCCGCGACCAGTTGCTGGCGCGCGCCGCCGAGGACCCGCGCCTGGCCAACGTGATGTTCGCCGGCCAGGGCGAGGCGCCGCAG
ATCCGCCTGGACATCGACCGGCGCAAGGCGGAGACCCTTGGCGTGAGCATGGACGAGATCAACACCACCCTGGCGGTGATGTTCGGCTCG
GACTACATCGGCGACTTCATGCACGGCAGCCAGGTGCGCAAGGTGGTGGTCCAGGCCGACCGGCGCAAGCGCCTGGGCATCGACGACATC
GGCCGGCTTCACGTGCGCAACGAGCAGGGCGAGATGGGTGCCGCTGGCGACGTTCGCCAAGGCCGCCTGGACCCTCGGCCCGCCGCAACT
GACCCGCTACAACGGCTATCCCTCGTTCAACCTCGAGGGCCAGGCCGCGCCGGGCTACAGCAGCGCGAAGCCATGCAGGCGATGGAGCAA
TTGATGCAGGGAACTGCCCGAGGCATTCGCCCACGAGTGGTCCGGCCAGTCCTTCGAAGAACGCCTGTTGCCGGCGCCCAGGCGCCGGCG
CTGTTCGCCCTCTCGGTGTTGATCGTGTTCCTCGCCCTGGCCGCCCTCTACGAAAGCTGGTCGATCCCGCTGGCGGTGATCCTGGTGGTG
CCGCTGGGCGTACTCGGCGCACTGCTCGGGGTGAGCCTGCGCGGTCTGCCCAACGACATCTACTTCAAGGTCGGCCTGATCACCATCATC
GGCCTCTCGGCGAAGAACGCCATCCTCATCATCGAGGTGGCCAAGGACCATTACCAGGAAGGCATGAGCCTGCTGCAGGCGACCCTGGAG
GCCGCGCGCCTGCGCCTGCGACCGATCGTCATGACCTCGCTGGCGTTCGGTTTCGGCGTGGTCCCGCTGGCGCTCTCCAGCGGCGCCGGT
ATCCGCGCCCAGGTCGCCATCGGCACCGGGGTGCTCGGCGGGATCGTCACCGCCACGGTACTCGCGGTGTTCCTGGTACCGCTGTTCTTC
CTGGTGGTCGGGCGCCTGTTCCGGTTGCGCAAGGCGCCGCGCACCGGCAACTCGCCCCAGATCCCCACGGAGCAAGCCTGA