Klebsiella pneumoniae KpnE

Download Sequences

Accession	ARO:3004580
Synonym(s)	A6T8S5
CARD Short Name	Kpne_KpnE
Definition	KpnE subunit of KpnEF resembles EbrAB from E. coli. Mutation in KpnEF resulted in increased susceptibility to cefepime, ceftriaxon, colistin, erythromycin, rifampin, tetracycline, and streptomycin as well as enhanced sensitivity toward sodium dodecyl sulfate, deoxycholate, dyes, benzalkonium chloride, chlorhexidine, and triclosan.
AMR Gene Family	small multidrug resistance (SMR) antibiotic efflux pump
Drug Class	peptide antibiotic, cephalosporin, disinfecting agents and antiseptics, rifamycin antibiotic, tetracycline antibiotic, aminoglycoside antibiotic, macrolide antibiotic
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Klebsiella aerogenes^g, Klebsiella pneumoniae^g+wgs
Resistomes with Sequence Variants	Citrobacter amalonaticus^g+wgs, Citrobacter freundii^g+wgs, Citrobacter koseri^g+wgs, Citrobacter portucalensis^g+wgs, Citrobacter werkmanii^g+wgs, Citrobacter youngae^g+wgs, Cronobacter condimenti^g+wgs, Cronobacter dublinensis^g+wgs, Cronobacter malonaticus^g+wgs, Cronobacter sakazakii^g+wgs, Cronobacter turicensis^wgs, Cronobacter universalis^g+wgs, Enterobacter asburiae^g+wgs, Enterobacter cancerogenus^g+wgs, Enterobacter chengduensis^g+wgs, Enterobacter cloacae^g+wgs, Enterobacter hormaechei^g+wgs, Enterobacter kobei^g+wgs, Enterobacter roggenkampii^g+wgs, Escherichia albertii^g+wgs, Escherichia coli^g+p+wgs, Escherichia marmotae^g+wgs, Klebsiella aerogenes^g+wgs, Klebsiella huaxiensis^g+wgs, Klebsiella michiganensis^g+wgs, Klebsiella oxytoca^g+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^g+wgs, Kosakonia arachidis^g+wgs, Leclercia adecarboxylata^g+wgs, Pseudomonas aeruginosa^wgs, Raoultella planticola^g+wgs, Salmonella bongori^g+wgs, Salmonella enterica^g+wgs, Shigella boydii^g+wgs, Shigella dysenteriae^g+wgs, Shigella flexneri^g+wgs, Shigella sonnei^g+wgs
Classification	31 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + peptide antibiotic [Drug Class] + lipopeptide antibiotic + beta-lactam antibiotic + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic efflux [Resistance Mechanism] + cephalosporin [Drug Class] + polymyxin antibiotic + fourth-generation cephalosporin + third-generation cephalosporin + disinfecting agents and antiseptics [Drug Class] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component] + rifamycin antibiotic [Drug Class] + tetracycline antibiotic [Drug Class] + colistin + aminoglycoside antibiotic [Drug Class] + macrolide antibiotic [Drug Class] + chlorhexidine [Antibiotic] + benzalkonium chloride [Antibiotic] + triclosan [Antibiotic] + colistin B [Antibiotic] + colistin A [Antibiotic] + rifampin [Antibiotic] + small multidrug resistance (SMR) antibiotic efflux pump [AMR Gene Family] + ceftriaxone [Antibiotic] + cefepime [Antibiotic] + tetracycline [Antibiotic] + streptomycin [Antibiotic] + erythromycin [Antibiotic]
Parent Term(s)	3 ontology terms \| Show + confers_resistance_to_drug_class cephalosporin [Drug Class] + subunit of efflux pump conferring antibiotic resistance + part_of Klebsiella pneumoniae KpnEF
Publications	Srinivasan VB, et al. 2013. Antimicrob. Agents Chemother. 57(9):4449-62 KpnEF, a new member of the Klebsiella pneumoniae cell envelope stress response regulon, is an SMR-type efflux pump involved in broad-spectrum antimicrobial resistance. (PMID 23836167)

Resistomes

Prevalence of Klebsiella pneumoniae KpnE among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter amalonaticus	0%	0%	0%	0%	0%
Citrobacter amalonaticus	100%	0%	100%	0%	0%
Citrobacter freundii	0%	0%	0%	0%	0%
Citrobacter freundii	100%	0%	98.84%	0%	0%
Citrobacter koseri	100%	0%	100%	0%	0%
Citrobacter koseri	0%	0%	0%	0%	0%
Citrobacter portucalensis	100%	0%	99.1%	0%	0%
Citrobacter portucalensis	0%	0%	0%	0%	0%
Citrobacter werkmanii	100%	0%	100%	0%	0%
Citrobacter werkmanii	0%	0%	0%	0%	0%
Citrobacter youngae	100%	0%	100%	0%	0%
Citrobacter youngae	0%	0%	0%	0%	0%
Cronobacter condimenti	0%	0%	0%	0%	0%
Cronobacter condimenti	100%	0%	100%	0%	0%
Cronobacter dublinensis	100%	0%	100%	0%	0%
Cronobacter dublinensis	0%	0%	0%	0%	0%
Cronobacter malonaticus	100%	0%	98.18%	0%	0%
Cronobacter malonaticus	0%	0%	0%	0%	0%
Cronobacter sakazakii	100%	0%	98.65%	0%	0%
Cronobacter sakazakii	0%	0%	0%	0%	0%
Cronobacter turicensis	0%	0%	0%	0%	0%
Cronobacter turicensis	0%	0%	100%	0%	0%
Cronobacter universalis	100%	0%	100%	0%	0%
Cronobacter universalis	0%	0%	0%	0%	0%
Enterobacter asburiae	100%	0%	99.21%	0%	0%
Enterobacter asburiae	0%	0%	0%	0%	0%
Enterobacter cancerogenus	100%	0%	100%	0%	0%
Enterobacter cancerogenus	0%	0%	0%	0%	0%
Enterobacter chengduensis	100%	0%	100%	0%	0%
Enterobacter chengduensis	0%	0%	0%	0%	0%
Enterobacter cloacae	100%	0%	99.04%	0%	0%
Enterobacter cloacae	0%	0%	0%	0%	0%
Enterobacter hormaechei	0%	0%	0%	0%	0%
Enterobacter hormaechei	99.28%	0%	99.31%	0%	0%
Enterobacter kobei	0%	0%	0%	0%	0%
Enterobacter kobei	100%	0%	100%	0%	0%
Enterobacter roggenkampii	93.02%	0%	98.92%	0%	0%
Enterobacter roggenkampii	0%	0%	0%	0%	0%
Escherichia albertii	100%	0%	100%	0%	0%
Escherichia albertii	0%	0%	0%	0%	0%
Escherichia coli	0%	0%	0%	0%	0%
Escherichia coli	67.63%	0.03%	98.87%	0%	96.63%
Escherichia marmotae	100%	0%	97.92%	0%	0%
Escherichia marmotae	0%	0%	0%	0%	0%
Klebsiella aerogenes	100%	0%	100%	0%	0%
Klebsiella aerogenes	2%	0%	0%	0%	0%
Klebsiella huaxiensis	100%	0%	100%	0%	0%
Klebsiella huaxiensis	0%	0%	0%	0%	0%
Klebsiella michiganensis	98.39%	0%	100%	0%	0%
Klebsiella michiganensis	0%	0%	0%	0%	0%
Klebsiella oxytoca	100%	0%	100%	0%	0%
Klebsiella oxytoca	0%	0%	0%	0%	0%
Klebsiella pneumoniae	99.17%	0.01%	99.18%	0%	0%
Klebsiella pneumoniae	18.58%	0%	17.62%	0%	0%
Klebsiella quasipneumoniae	100%	0%	99.74%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0%	0%	0%
Kosakonia arachidis	100%	0%	100%	0%	0%
Kosakonia arachidis	0%	0%	0%	0%	0%
Leclercia adecarboxylata	85.71%	0%	100%	0%	0%
Leclercia adecarboxylata	0%	0%	0%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%
Pseudomonas aeruginosa	0%	0%	0%	0%	0%
Raoultella planticola	0%	0%	0%	0%	0%
Raoultella planticola	100%	0%	100%	0%	0%
Salmonella bongori	100%	0%	100%	0%	0%
Salmonella bongori	0%	0%	0%	0%	0%
Salmonella enterica	95.52%	0%	99.46%	0%	0%
Salmonella enterica	0%	0%	0%	0%	0%
Shigella boydii	100%	0%	100%	0%	0%
Shigella boydii	0%	0%	0%	0%	0%
Shigella dysenteriae	0%	0%	0%	0%	0%
Shigella dysenteriae	100%	0%	86.67%	0%	0%
Shigella flexneri	0%	0%	0%	0%	0%
Shigella flexneri	100%	0%	99.53%	0%	0%
Shigella sonnei	0%	0%	0%	0%	0%
Shigella sonnei	97.56%	0%	98.98%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 150

Protein
DNA

>gb|BAH63251.1|+|Klebsiella pneumoniae KpnE [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MFYWILLALAIIAEITGTLSMKWASVSGGHTGFILMLAMIALSYIFLAFAVKKIALGVAYALWEGIGILLITLFSVLLFDESLSLLKIAG
LTTLVIGIVLIKSGTQKKASSQQEVAHAAV

>gb|AP006725.1|+|2483890-2484252|Klebsiella pneumoniae KpnE [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
ATGTTTTATTGGATTTTATTAGCTTTAGCAATTATTGCTGAAATTACCGGCACCTTGTCTATGAAATGGGCAAGCGTGAGCGGCGGGCAC
ACCGGCTTTATTTTAATGCTGGCCATGATTGCCCTGTCATATATTTTTCTTGCCTTTGCGGTTAAAAAGATTGCCCTCGGTGTGGCCTAT
GCGTTGTGGGAAGGGATCGGTATTTTACTGATTACCCTGTTCAGCGTGCTGCTGTTTGATGAGAGTCTGTCCCTGCTGAAAATAGCCGGC
TTGACCACCCTGGTGATAGGGATCGTCTTAATTAAGTCCGGCACCCAGAAAAAAGCGTCTTCACAGCAGGAGGTGGCCCATGCAGCAGTT
TGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

Klebsiella pneumoniae KpnE

Prevalence: protein homolog model (view sequences)

Graph