Klebsiella pneumoniae KpnF

Accession ARO:3004583
Synonym(s)A6T8S6
CARD Short NameKpne_KpnF
DefinitionKpnF subunit of KpnEF resembles EbrAB from E. coli. Mutation in KpnEF resulted in increased susceptibility to cefepime, ceftriaxon, colistin, erythromycin, rifampin, tetracycline, and streptomycin as well as enhanced sensitivity toward sodium dodecyl sulfate, deoxycholate, dyes, benzalkonium chloride, chlorhexidine, and triclosan.
AMR Gene Familysmall multidrug resistance (SMR) antibiotic efflux pump
Drug Classpeptide antibiotic, cephalosporin, disinfecting agents and antiseptics, rifamycin antibiotic, tetracycline antibiotic, aminoglycoside antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesKlebsiella aerogenesg, Klebsiella pneumoniaeg+p+wgs
Resistomes with Sequence VariantsCitrobacter amalonaticusg+wgs, Citrobacter freundiig+wgs, Citrobacter koserig+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniig+wgs, Citrobacter youngaeg+wgs, Cronobacter condimentig+wgs, Cronobacter dublinensisg+wgs, Cronobacter malonaticusg+wgs, Cronobacter sakazakiig+wgs, Cronobacter turicensiswgs, Cronobacter universalisg+wgs, Edwardsiella tardag+wgs, Enterobacter asburiaeg+wgs, Enterobacter cancerogenusg+wgs, Enterobacter chengduensisg+wgs, Enterobacter cloacaeg+wgs, Enterobacter hormaecheig+wgs, Enterobacter kobeig+wgs, Enterobacter roggenkampiig+wgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia marmotaeg+wgs, Klebsiella aerogenesg+wgs, Klebsiella huaxiensisg+wgs, Klebsiella michiganensisg+wgs, Klebsiella oxytocag+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaeg+wgs, Kosakonia arachidisg+wgs, Leclercia adecarboxylatag+wgs, Leminorella grimontiiwgs, Photorhabdus asymbioticag+wgs, Proteus columbaeg+wgs, Proteus mirabilisg+wgs, Proteus pennerig+wgs, Proteus vulgarisg+wgs, Providencia alcalifaciensg+wgs, Providencia heimbachaeg+wgs, Providencia rettgerig+wgs, Providencia stuartiig+wgs, Raoultella planticolag+wgs, Salmonella bongorig+wgs, Salmonella entericag+wgs, Serratia liquefaciensg+wgs, Serratia marcescensg+p+wgs, Serratia odoriferag+wgs, Serratia rubidaeag+wgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs, Yersinia canariaeg+wgs, Yersinia enterocoliticag+wgs, Yersinia kristenseniig+wgs, Yersinia pestisg+wgs, Yersinia pseudotuberculosisg+wgs
Classification31 ontology terms | Show
Parent Term(s)3 ontology terms | Show
Publications

Srinivasan VB, et al. 2013. Antimicrob. Agents Chemother. 57(9):4449-62 KpnEF, a new member of the Klebsiella pneumoniae cell envelope stress response regulon, is an SMR-type efflux pump involved in broad-spectrum antimicrobial resistance. (PMID 23836167)

Resistomes

Prevalence of Klebsiella pneumoniae KpnF among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Citrobacter amalonaticus100%0%98.18%0%0%
Citrobacter freundii100%0%99.23%0%0%
Citrobacter koseri100%0%100%0%0%
Citrobacter portucalensis100%0%100%0%0%
Citrobacter werkmanii100%0%100%0%0%
Citrobacter youngae100%0%100%0%0%
Cronobacter condimenti100%0%50%0%0%
Cronobacter dublinensis100%0%94.87%0%0%
Cronobacter malonaticus100%0%96.36%0%0%
Cronobacter sakazakii100%0%83.18%0%0%
Cronobacter turicensis0%0%100%0%0%
Cronobacter universalis100%0%100%0%0%
Edwardsiella tarda100%0%93.33%0%0%
Enterobacter asburiae100%0%98.81%0%0%
Enterobacter cancerogenus100%0%100%0%0%
Enterobacter chengduensis100%0%100%0%0%
Enterobacter cloacae100%0%98.72%0%0%
Enterobacter hormaechei98.92%0%99.14%0%0%
Enterobacter kobei100%0%100%0%0%
Enterobacter roggenkampii100%0%100%0%0%
Escherichia albertii100%0%100%0%0%
Escherichia coli67.84%0.03%99.31%0%99.47%
Escherichia marmotae100%0%97.92%0%0%
Klebsiella aerogenes100%0%100%0%0%
Klebsiella huaxiensis100%0%100%0%0%
Klebsiella michiganensis98.39%0%100%0%0%
Klebsiella oxytoca100%0%100%0%0%
Klebsiella pneumoniae99.17%0.01%99.21%0%0%
Klebsiella quasipneumoniae100%0%99.74%0%0%
Kosakonia arachidis100%0%100%0%0%
Leclercia adecarboxylata92.86%0%100%0%0%
Leminorella grimontii0%0%85.71%0%0%
Photorhabdus asymbiotica100%0%100%0%0%
Proteus columbae100%0%100%0%0%
Proteus mirabilis100%0%99.01%0%0%
Proteus penneri100%0%100%0%0%
Proteus vulgaris100%0%94.44%0%0%
Providencia alcalifaciens100%0%100%0%0%
Providencia heimbachae100%0%100%0%0%
Providencia rettgeri100%0%100%0%0%
Providencia stuartii100%0%100%0%0%
Raoultella planticola100%0%100%0%0%
Salmonella bongori100%0%100%0%0%
Salmonella enterica95.14%0%98.57%0%0%
Serratia liquefaciens100%0%100%0%0%
Serratia marcescens98.48%0.65%98.17%0%0%
Serratia odorifera100%0%100%0%0%
Serratia rubidaea100%0%100%0%0%
Shigella boydii100%0%100%0%0%
Shigella dysenteriae100%0%96.67%0%0%
Shigella flexneri100%0%99.38%0%0%
Shigella sonnei97.56%0%98.61%0%0%
Yersinia canariae100%0%100%0%0%
Yersinia enterocolitica100%0%99.09%0%0%
Yersinia kristensenii100%0%100%0%0%
Yersinia pestis100%0%99.61%0%0%
Yersinia pseudotuberculosis100%0%97.06%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 150


>gb|BAH63252.1|+|Klebsiella pneumoniae KpnF [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MQQFEWIHAAWLAIAIVLEIIANVFLKFSDGFRRKIYGILSLAAVLGAFSALSQAVKGIDLSVAYALWGGFGIAATIAAGWVLFGQRLNN
KGWAGVILLVAGMVLIKLA


>gb|AP006725.1|+|2484239-2484568|Klebsiella pneumoniae KpnF [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
ATGCAGCAGTTTGAGTGGATCCACGCCGCCTGGCTGGCAATCGCCATTGTGCTGGAAATTATTGCCAACGTCTTTTTGAAGTTTTCCGAC
GGCTTCCGCCGCAAGATCTACGGCATCCTGTCCCTGGCGGCAGTATTGGGCGCGTTCAGCGCCCTGTCGCAGGCGGTTAAAGGGATCGAT
CTCTCGGTCGCCTATGCGCTGTGGGGCGGCTTCGGTATCGCGGCGACCATCGCCGCCGGCTGGGTGCTGTTTGGTCAGCGTCTGAATAAC
AAAGGCTGGGCGGGGGTTATCCTGCTGGTAGCCGGCATGGTGTTAATTAAACTCGCCTGA

Curator Acknowledgements
Curator Description Most Recent Edit