ErmA

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000347
Synonym(s)ermTR
CARD Short NameErmA
DefinitionErmA confers the MLSb phenotype. Similar to ErmC, Expression of ErmA is inducible by erythromycin. The leader peptide causes attenuation of the mRNA and stabilizes the structure preventing further translation. When erythromycin is present, it binds the leader peptide causing a change in conformation allowing for the expression of ErmA.
AMR Gene FamilyErm-like 23S rRNA methyltransferase
Drug Classstreptogramin antibiotic, lincosamide antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic target alteration
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONStaphylococcus aureus (36), Staphylococcus epidermidis (5), Staphylococcus (4), Streptococcus pyogenes (3), Enterococcus faecalis (3), Enterococcus faecium (3), Streptococcus (3), Enterococcus (2), Streptococcus pneumoniae (2), Streptococcus agalactiae (2)
GAZ
FOODONswine (4), chicken (2), food (ready-to-serve) (2), water food product (2), turkey (bird) (2), poultry drumstick (2)
ENVOhospital (5), farm (4)
UBERONblood (2)
Classification15 ontology terms | Show
Parent Term(s)25 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic roxithromycin [Antibiotic]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic telithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clarithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ confers_resistance_to_antibiotic tylosin [Antibiotic]
+ confers_resistance_to_antibiotic spiramycin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ confers_resistance_to_antibiotic dirithromycin [Antibiotic]
+ Erm-like 23S rRNA methyltransferase [AMR Gene Family]
+ confers_resistance_to_antibiotic pristinamycin IA [Antibiotic]
+ confers_resistance_to_antibiotic quinupristin [Antibiotic]
+ confers_resistance_to_antibiotic virginiamycin M1 [Antibiotic]
+ confers_resistance_to_antibiotic madumycin II [Antibiotic]
+ confers_resistance_to_antibiotic griseoviridin [Antibiotic]
+ confers_resistance_to_antibiotic dalfopristin [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IB [Antibiotic]
+ confers_resistance_to_antibiotic virginiamycin S2 [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IC [Antibiotic]
+ confers_resistance_to_antibiotic vernamycin C [Antibiotic]
+ confers_resistance_to_antibiotic patricin A [Antibiotic]
+ confers_resistance_to_antibiotic patricin B [Antibiotic]
+ confers_resistance_to_antibiotic ostreogrycin B3 [Antibiotic]
+ confers_resistance_to_antibiotic oleandomycin [Antibiotic]
Resistomes with Perfect MatchesEnterococcus aviumg+wgs, Enterococcus faecaliswgs, Enterococcus faeciumg+p+wgs+gi, Staphylococcus aureusg+wgs+gi, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+wgs+gi, Staphylococcus haemolyticusg+wgs, Staphylococcus hominiswgs, Staphylococcus lugdunensisg+wgs, Staphylococcus pseudintermediusg, Staphylococcus simulanswgs
Resistomes with Sequence VariantsCampylobacter colig+wgs, Clostridium perfringensp+wgs, Enterococcus aviumg+wgs, Enterococcus faecalisg+p+wgs+gi, Enterococcus faeciumg+p+wgs+gi, Enterococcus hiraewgs, Lactobacillus crispatusg+wgs, Lactococcus garvieaep, Listeria innocuag, Staphylococcus aureusg+wgs+gi, Staphylococcus capitisg+wgs, Staphylococcus epidermidisg+wgs+gi, Staphylococcus haemolyticusg+wgs, Staphylococcus hominiswgs, Staphylococcus lugdunensisg+wgs, Staphylococcus pseudintermediusg, Staphylococcus simulansg+wgs, Streptococcus gallolyticuswgs, Streptococcus suisg+wgs
Publications

Malhotra-Kumar S, et al. 2008. J Antimicrob Chemother 63(1): 42-46. Unusual resistance patterns in macrolide-resistant Streptococcus pyogenes harbouring erm(A). (PMID 18952616)

Resistomes

Prevalence of ErmA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Campylobacter coli1.45%0%0.53%0%0%
Clostridium perfringens0%1.93%0.49%0%0%
Enterococcus avium33.33%0%17.54%0%0%
Enterococcus faecalis7.27%7.64%7.8%8.33%0%
Enterococcus faecium4.46%1.49%7.67%3.92%0%
Enterococcus hirae0%0%5.56%0%0%
Lactobacillus crispatus4%0%0.27%0%0%
Lactococcus garvieae0%4.17%0%0%0%
Listeria innocua5.88%0%0%0%0%
Staphylococcus aureus17.1%0%35.02%23.5%0%
Staphylococcus capitis30%0%26.58%0%0%
Staphylococcus epidermidis6.45%0%2.68%8.57%0%
Staphylococcus haemolyticus3.45%0%2.2%0%0%
Staphylococcus hominis0%0%0.98%0%0%
Staphylococcus lugdunensis5.56%0%1.54%0%0%
Staphylococcus pseudintermedius3.33%0%0%0%0%
Staphylococcus simulans5%0%6.78%0%0%
Streptococcus gallolyticus0%0%4.55%0%0%
Streptococcus suis8%0%3.46%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|CAA26964.1|-|ErmA [Staphylococcus aureus]
MNQKNPKDTQNFITSKKHVKEILNHTNISKQDNVIEIGSGKGHFTKELVKMSRSVTAIEIDGGLCQVTKEAVNPSENIKVIQTDILKFSF
PKHINYKIYGNIPYNISTDIVKRITFESQAKYSYLIVEKGFAKRLQNLQRALGLLLMVEMDIKMLKKVPPLYFHPKPSVDSVLIVLERHQ
PLISKKDYKKYRSFVYKWVNREYRVLFTKNQFRQALKHANVTNINKLSKEQFLSIFNSYKLFH


>gb|X03216.1|-|4551-5282|ErmA [Staphylococcus aureus]
ATGAACCAGAAAAACCCTAAAGACACGCAAAATTTTATTACTTCTAAAAAGCATGTAAAAGAAATATTGAATCACACGAATATCAGTAAA
CAAGACAACGTAATAGAAATCGGATCAGGAAAAGGACATTTTACCAAAGAGCTAGTCAAAATGAGTCGATCAGTTACTGCTATAGAAATT
GATGGAGGCTTATGTCAAGTGACTAAAGAAGCGGTAAACCCCTCTGAGAATATAAAAGTGATTCAAACGGATATTCTAAAATTTTCCTTC
CCAAAACATATAAACTATAAGATATATGGTAATATTCCTTATAACATCAGTACGGATATTGTCAAAAGAATTACCTTTGAAAGTCAGGCT
AAATATAGCTATCTTATCGTTGAGAAGGGATTTGCGAAAAGATTGCAAAATCTGCAACGAGCTTTGGGTTTACTATTAATGGTGGAGATG
GATATAAAAATGCTCAAAAAAGTACCACCACTATATTTTCATCCTAAGCCAAGTGTAGACTCTGTATTGATTGTTCTTGAACGACATCAA
CCATTGATTTCAAAGAAGGACTACAAAAAGTATCGATCTTTTGTTTATAAGTGGGTAAACCGTGAATATCGTGTTCTTTTCACTAAAAAC
CAATTCCGACAGGCTTTGAAGCATGCAAATGTCACTAATATTAATAAACTATCGAAGGAACAATTTCTTTCTATTTTCAATAGTTACAAA
TTGTTTCACTAA

Curator Acknowledgements
Curator Description Most Recent Edit