ErmC

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000250
Synonym(s)ErmC' ermIM ermM
CARD Short NameErmC
DefinitionErmC is a methyltransferase that catalyzes the methylation of A2058 of the 23S ribosomal RNA in two steps. Expression of ErmC is inducible by erythromycin. The leader peptide causes attenuation of the mRNA and stabilizes the structure preventing further translation. When erythromycin is present, it binds the leader peptide causing a change in conformation allowing for the expression of ErmC.
AMR Gene FamilyErm-like 23S rRNA methyltransferase
Drug Classstreptogramin antibiotic, lincosamide antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic target alteration
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONStaphylococcus aureus (34), Staphylococcus epidermidis (10), Staphylococcus (6), Enterococcus (3), Streptococcus (3), Enterococcus faecalis (3), Enterococcus faecium (3), Salmonella (2), Neisseria (2), Listeria monocytogenes (2)
GAZ
FOODONwater food product (3), swine (2), poultry drumstick (2), chicken (2)
ENVOhospital (6)
UBERONanimal hemisphere (4), blood (2)
Classification15 ontology terms | Show
Parent Term(s)25 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic roxithromycin [Antibiotic]
+ confers_resistance_to_antibiotic lincomycin [Antibiotic]
+ confers_resistance_to_antibiotic telithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clarithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ confers_resistance_to_antibiotic tylosin [Antibiotic]
+ confers_resistance_to_antibiotic spiramycin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ confers_resistance_to_antibiotic dirithromycin [Antibiotic]
+ Erm-like 23S rRNA methyltransferase [AMR Gene Family]
+ confers_resistance_to_antibiotic pristinamycin IA [Antibiotic]
+ confers_resistance_to_antibiotic quinupristin [Antibiotic]
+ confers_resistance_to_antibiotic virginiamycin M1 [Antibiotic]
+ confers_resistance_to_antibiotic madumycin II [Antibiotic]
+ confers_resistance_to_antibiotic griseoviridin [Antibiotic]
+ confers_resistance_to_antibiotic dalfopristin [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IB [Antibiotic]
+ confers_resistance_to_antibiotic virginiamycin S2 [Antibiotic]
+ confers_resistance_to_antibiotic pristinamycin IC [Antibiotic]
+ confers_resistance_to_antibiotic vernamycin C [Antibiotic]
+ confers_resistance_to_antibiotic patricin A [Antibiotic]
+ confers_resistance_to_antibiotic patricin B [Antibiotic]
+ confers_resistance_to_antibiotic ostreogrycin B3 [Antibiotic]
+ confers_resistance_to_antibiotic oleandomycin [Antibiotic]
Resistomes with Sequence VariantsBacillus cereusp+wgs, Bacillus subtiliswgs, Bacillus velezensiswgs, Burkholderia cepaciawgs, Corynebacterium diphtheriaewgs, Enterococcus faecaliswgs, Enterococcus faeciumwgs, Escherichia coliwgs, Francisella tularensiswgs, Klebsiella pneumoniaewgs, Listeria monocytogeneswgs, Neisseria gonorrhoeaewgs, Neisseria meningitidisg, Pseudomonas aeruginosawgs, Rhizobium leguminosarumwgs, Serratia marcescenswgs, Shigella sonneiwgs, Staphylococcus arlettaewgs, Staphylococcus aureusg+p+wgs+gi, Staphylococcus capitiswgs, Staphylococcus epidermidisg+p+wgs, Staphylococcus equorumwgs, Staphylococcus haemolyticusg+p+wgs+gi, Staphylococcus hominisp+wgs, Staphylococcus lugdunensisp+wgs, Staphylococcus pseudintermediuswgs, Staphylococcus saprophyticuswgs, Staphylococcus warneriwgs, Streptococcus pneumoniaewgs, Streptococcus pyogenesp+wgs
Publications

Shivakumar AG and Dubnau D. 1981. Nucleic Acids Res 9(11): 2549-2562. Characterization of a plasmid-specified ribosome methylase associated with macrolide resistance. (PMID 6792593)

Mayford M and Weisblum B. 1990. J Bacteriol 172(7): 3772-3779. The ermC leader peptide: amino acid alterations leading to differential efficiency of induction by macrolide-lincosamide-streptogramin B antibiotics. (PMID 2113911)

Denoya C and Dubnau D. 1989. J Biol Chem 264(5): 2615-2624. Mono- and dimethylating activities and kinetic studies of the ermC 23 S rRNA methyltransferase. (PMID 2492520)

Vazquez-Laslop N, et al. 2008. Mol Cell 30(2): 190-202. Molecular mechanism of drug-dependent ribosome stalling. (PMID 18439898)

Resistomes

Prevalence of ErmC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Bacillus cereus0%0.3%0.1%0%0%
Bacillus subtilis0%0%0.29%0%0%
Bacillus velezensis0%0%0.37%0%0%
Burkholderia cepacia0%0%0.45%0%0%
Corynebacterium diphtheriae0%0%0.31%0%0%
Enterococcus faecalis0%0%0.37%0%0%
Enterococcus faecium0%0%0.03%0%0%
Escherichia coli0%0%0.01%0%0%
Francisella tularensis0%0%1.06%0%0%
Klebsiella pneumoniae0%0%0.03%0%0%
Listeria monocytogenes0%0%0.12%0%0%
Neisseria gonorrhoeae0%0%0.22%0%0%
Neisseria meningitidis0.76%0%0%0%0%
Pseudomonas aeruginosa0%0%0.03%0%0%
Rhizobium leguminosarum0%0%0.2%0%0%
Serratia marcescens0%0%0.13%0%0%
Shigella sonnei0%0%0.07%0%0%
Staphylococcus arlettae0%0%12.5%0%0%
Staphylococcus aureus1.13%5.84%16.3%0.29%0%
Staphylococcus capitis0%0%6.96%0%0%
Staphylococcus epidermidis2.58%3.75%25.77%0%0%
Staphylococcus equorum0%0%3.57%0%0%
Staphylococcus haemolyticus3.45%3.77%23.3%6.67%0%
Staphylococcus hominis0%4.17%17.56%0%0%
Staphylococcus lugdunensis0%5.36%3.08%0%0%
Staphylococcus pseudintermedius0%0%0.26%0%0%
Staphylococcus saprophyticus0%0%4.9%0%0%
Staphylococcus warneri0%0%7.38%0%0%
Streptococcus pneumoniae0%0%0.02%0%0%
Streptococcus pyogenes0%20%0.05%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|AAA98296.1|+|ErmC [Staphylococcus epidermidis]
MNEKNIKHSQNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEIDHKLCKTTENKLVDHDNFQVLNKDILQFKF
PKNQSYKIFGNIPYNISTDIIRKIVFDSIADEIYLIVEYGFAKRLLNTKRSFALFLMAEVDISILSMVPREYFHPKPKVNSSLIRLNRKK
SRISHKDKQKYNYFVMKWVNKEYKKIFTKNQFNNSLKHAGIDDLNNISFEQFLSLFNSYKLFNK


>gb|M12730.1|+|780-1514|ErmC [Staphylococcus epidermidis]
ATGAACGAGAAAAATATAAAACACAGTCAAAACTTTATTACTTCAAAACATAATATAGATAAAATAATGACAAATATAAGATTAAATGAA
CATGATAATATCTTTGAAATCGGCTCAGGAAAAGGGCATTTTACCCTTGAATTAGTACAGAGGTGTAATTTCGTAACTGCCATTGAAATA
GACCATAAATTATGCAAAACTACAGAAAATAAACTTGTTGATCACGATAATTTCCAAGTTTTAAACAAGGATATATTGCAGTTTAAATTT
CCTAAAAACCAATCCTATAAAATATTTGGTAATATACCTTATAACATAAGTACGGATATAATACGCAAAATTGTTTTTGATAGTATAGCT
GATGAGATTTATTTAATCGTGGAATACGGGTTTGCTAAAAGATTATTAAATACAAAACGCTCATTCGCATTATTTTTAATGGCAGAAGTT
GATATTTCTATATTAAGTATGGTTCCAAGAGAATATTTTCATCCTAAACCTAAAGTGAATAGCTCACTTATCAGATTAAATAGAAAAAAA
TCAAGAATATCACACAAAGATAAACAGAAGTATAATTATTTCGTTATGAAATGGGTTAACAAAGAATACAAGAAAATATTTACAAAAAAT
CAATTTAACAATTCCTTAAAACATGCAGGAATTGACGATTTAAACAATATTAGCTTTGAACAATTCTTATCTCTTTTCAATAGCTATAAA
TTATTTAATAAGTAA

Curator Acknowledgements
Curator Description Most Recent Edit